ftp.xmission.com/2014.06.ftp.xmission.com.tar/ftp.xmission.com/pub/lists/fractint/archive/fractint.200011

Internet Message Format | 2000-11-30 | 349KB

From: Bob Margolis <[e-mail]>
Subject: (fractint) Fractal Geometry Summer Workshop
Date: 01 Nov 2000 04:59:20 -0600

Roger Bagula posted the following URL to a couple of the fractal
newsgroups. It may be of interest to the newbies amongst us who want to
know the mechanics behind the Mandelbrot and Julia Sets.

Bob

==========

Introduction to Fractal Geometry

Yale University, August 2000.

Michael Frame and Benoit Mandelbrot

http://classes.yale.edu/99-00/math190a/index.html

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) FOTD  01-11-00  (Old Gold Minibrot [4])
Date: 01 Nov 2000 07:26:45 -0500 (EST)


FOTD -- November 01, 2000 (Rating 5)

Fractal visionaries and enthusiasts:

I'm posting this at 7:15am because last evening both internet
providers were inaccessible.

This afternoon, (October 31), while browsing the fine selection
of fractals posted to A.B.P.F., I wondered whether such images
can honestly be called fractals.  Then, realizing how the idea
of what constitutes a fractal has changed in recent years, I
wondered whether the old-fashioned style images I post in the
FOTD can still be called fractals.  Since the nature of the two
styles of images is so different, I doubt that both can still
be considered fractals.

The images I create are done more in fun than with creative
effort, usually involving little more than flat iteration bands
and an adequate color palette.  Sometimes the time from boot-up
to completed image is less than 15 minutes.  Except for the CPU
speed increase, this is the same way I worked with fractals 10
years ago.

But in that time, fractal programs have changed.  They have
evolved into virtual graphic programs.  This is good, for it
gives the fractalist much additional creative opportunity,
albeit at the expense of that vague and debatable ideal, fractal
purity.

However, I feel that we have reached the point where fractal art
has become so far removed from the original idea of fractals that
the two can no longer be considered the same thing.  This in no
way reduces my opinion of the more artistic images, but I feel
that some distinction must be made between the type of images I
create and the type of images that appear on A.B.P.F.

Since the more artistic fractalists remain satisfied calling the
images they produce fractals, I will change the description of
my images from fractals to classic fractals.  The appearance of
the images themselves, as well as the discussion will remain
unchanged.

As a simple example, today's image explores the fractal that
results when the expression Z^(-14)+2.5Z^(-1.45)+(1/C) is
iterated.  I named it "The Lost Minibrot" because that title
seemed poetic, and not because I lost it, which obviously is not
the case.  The picture rates a perfectly average 5.  The
parameter file renders in a dragging 14 minutes, making a
download of the GIF image file from:

          <alt.binaries.pictures.fractals>

or from:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

the far wiser choice.

The fractal weather today (Halloween) was perfect, and the cats
took full advantage of the perfection.  In the 61F (16C) degree
air they romped and frolicked until they exhausted themselves, a
time which is quite short for gloriously middle-aged classic
fractal cats.

I'll return tomorrow, (now later today), with another classic
fractal and more words of wisdom.  Until then, take care, and
regardless of what you call them, keep those fractals coming.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

The_Lost_Minibrot  { ; time=0:17:02.17 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=+1.85728145477441900/-0.23424119516995760\
  /5531863/1/162.499 params=1/-14/2.5/-1.45/0/0 float=y
  maxiter=1800 inside=0 logmap=204 periodicity=10
  colors=000X4A_5A_7A_8A<3>dEAfGAgHAhJAjIAlK9lL8lM7<9>\
  RF2OE2MD1<2>GB0EB0DC1<32>7eK7fL6gL<3>6jN<13>bqfdrhgr\
  i<2>ntnptoqqprtprjmrjjq`gq_dqUaqQ_<19>cmAco9bp8<3>`t\
  3<39>OGKOFKOEL<2>NBMNAMOBN<9>ODXODYODZOE_OE`<9>ONiOO\
  jOPk<2>OSnNTpOUn<3>OYjPZiP_hP`gPaf<3>_ebbfaeg`hi_<3>\
  ttWwwVzzU<18>zzBzzAzz9<2>zz7zz6zz6zz6<3>zz7
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "=?Windows-1252?B?UHVza+FzIElzdHbhbiBqci4=?=" <[e-mail]>
Subject: Midgets - Re: (fractint) FOTD  29-10-00  (The Green Goblet [5])
Date: 01 Nov 2000 22:34:02 +0100

>What is necessary for an image to have midgets? should the power o Z be
>greater than 2??

Are 'midgets' the smaller Mandelbrot-shapes in the main Mandelbrot-set and
the small 'clones' in other sets?
If yes:
I think that the iteration should be trapped with some starting values (the
value of 'Z' should settle to a low value, instead of increasing toward
infinity). The Mandelbrot-set and the 'connected' Julia-sets have this
behaviour, the 'unconnected' Julia-sets and some other formulas -
type=sierpinski, type=unity - don't. This may depend on the exponent in use
for some formulas.


Sorry for posting this so late, I forgot to send it.




Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: <[e-mail]>
Subject: Re: Midgets - Re: (fractint) FOTD  29-10-00  (The Green Goblet [5])
Date: 02 Nov 2000 15:01:10 +1300

=?Windows-1252?B?UHVza+FzIElzdHbhbiBqci4=?= (if that is the writer's name)
said:
> >What is necessary for an image to have midgets? should the power o Z be
> >greater than 2??
>
In the dynamic? As in z^2+c? I guess you mean "greater than or equal to 2".
Lemme just switch to Fractint for a sec...

Well, I found a recognisable Mandelbrot midget - a slightly nicked z^2+c-like
one - in z^1.9+c.

> Are 'midgets' the smaller Mandelbrot-shapes in the main Mandelbrot-set and
> the small 'clones' in other sets?
>
Yes; also called "minibrots" or sometimes "atoms".

> If yes:
> I think that the iteration should be trapped with some starting values (the
> value of 'Z' should settle to a low value, instead of increasing toward
> infinity). The Mandelbrot-set and the 'connected' Julia-sets have this
> behaviour, the 'unconnected' Julia-sets and some other formulas -
> type=sierpinski, type=unity - don't. This may depend on the exponent in use
> for some formulas.
>
The Mandelbrot Set and its Julia sets are defined by this property (z's being
bounded in magnitude): points within the set lead to bounded orbits, orbits
starting from points outside diverge towards infinity. In "unconnected" Julias
(or "dusts"), the set is - what topologists would call - of measure zero,
which is to say that the points of the set are isolated from each other. At
any finite resolution, therefore, all you see are points _outside_ the set.

In the Unity fractal, the set is the unit circle (hence the name): the fractal
fun & games is a consquence of the method for finding it.

I leave Sierpinski's gasket as an exercise for the reader.

None of this really helps in determining when (and where) midgets should
occur: the question gets even harder when you consider that some of these
midgets (an infinite number, in fact - nay, the vast majority) are so badly
distorted that they're often unrecognisable.

Morgan L. Owens
"Lesser fleas."

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "David Jones" <[e-mail]>
Subject: Re: (fractint) Fractal Geometry Summer Workshop
Date: 01 Nov 2000 18:38:37 -1000

The book "Turbulent Mirror" has a very good discussion
and explanation of fractals that would be very good for
newbies to fractals.

On  1 Nov 00 at 4:59, Bob Margolis wrote:

> Roger Bagula posted the following URL to a couple of the
> fractal newsgroups. It may be of interest to the newbies
> amongst us who want to know the mechanics behind the
> Mandelbrot and Julia Sets.

Another blast of bits from David
http://home.hawaii.rr.com/aliasjj/   http://www.hawastsoc.org/
For the best Hawaii & Pacific Basin surf forecast:
    http://www.surfreporthawaii.com

Random Thought for this Nanosecond
Sorry - insufficient processing power. Upgrade brain (y) (n)? (D.Jones)



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "David Jones" <[e-mail]>
Subject: Re: (fractint) FOTD  01-11-00  (Old Gold Minibrot [4])
Date: 01 Nov 2000 18:38:36 -1000

On  1 Nov 00 at 7:26, Jim Muth wrote:

> Since the more artistic fractalists remain satisfied
> calling the images they produce fractals, I will
> change the description of my images from fractals to
> classic fractals.

Wrong choice. *real* fractals. IMHO, fractal images using
layering et al - whether or not the layering is done in
the fractal generator or in a separate program - are
post-processed, and no longer fractals to me.

Another blast of bits from David
http://home.hawaii.rr.com/aliasjj/   http://www.hawastsoc.org/
For the best Hawaii & Pacific Basin surf forecast:
    http://www.surfreporthawaii.com

Random Thought for this Nanosecond
Observe with the eyes; work with the hands. (D.Jones)



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) Classic FOTD 02-11-00 (Meteor Impact [6])
Date: 02 Nov 2000 00:25:51 -0500 (EST)


Classic FOTD -- Nov. 02, 2000 (Rating 6)

Fractal visionaries and enthusiasts:

I hope I've got everything right tonight.  Last night, when I
tried to post my FOTD, I found both Mindspring (Earthlink) and
AOL inaccessible.  Finally, early this morning, when I gained
access, I forgot to update the image name.  But no harm done --
the image wasn't that good anyway.

Today's image is better, at least good enough to rate a somewhat
above average 6.  The brilliant object in the picture reminds me
of a meteor plunging through earth's atmosphere on its way to a
surface impact, which is why I named the image "Meteor Impact".

The actual meteor is a midget in a remote part of the Z^1.195+C
fractal.  And I did touch up the colors in a graphic program.

When I run the image through a graphic program, I never change
it so much that it cannot be defined in a parameter file, so
running the parameter file will produce exactly the same image
as has been posted to:

          <alt.binaries.pictures.fractals>

and to:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather was perfectly perfect all day, with a
temperature of 62F (16.5C) and not a single cloud to mar the
deep blue sky.  The fractal cats showed approval by lounging in
the yard for several hours, trying to decide what trouble to get
into.

My philosophical muse has been absent ever since I lost that
long FOTD article a few nights ago.  I'm hoping she'll return
before too long.  Until tomorrow, take care, and be good, but
not too good.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Meteor_Impact      { ; time=0:12:00.00 -- SF5 on a p200
  reset=2001 type=formula formulafile=branchct.frm
  formulaname=MandelbrotBC passes=1
  center-mag=-2.72959302366478800/+9.28940913170944800\
  /74.45881/1/90 params=1.195/0/4.671/0 float=y
  maxiter=75000 inside=255 logmap=22 periodicity=10
  colors=000B00B00E00G00H00L00M00P00R00U00V00X00_00_00\
  b00b00d00<2>e00e00g00<2>h00h10j10<2>k10k10m20n20n40p\
  40p40q60q60r60t70t70v90v90w90wB0yB0zB0zD0<2>zE1zE1zG\
  2zG2zG4zH4zH6zJ6zJ6zJ7zL7zL9zL9zMBzMBzL7zMB<3>zMHzMJ\
  zOM<3>zOSzOUzPX<3>zPbzPdzPezRhyRjyRkwRmwRnvRpvSrtStt\
  SvrSwrSyqSzqUzpUzpUznUznUzmUzqMzmUzhazdhyakrXkkSkePk\
  _RkYSkYUkXVkXXkVYkVYkR<2>bkadkddkg<3>jkrJkm<2>apzgqz\
  mrzrtzyvzzwzzyz<23>zzyzzyzzy<3>zzyzzzzzyzzvzzrzzpzzk\
  zzhzzezzbzzYzzVzzSzzPzzLzzHzzEzzBzz6zz2zz0zz0zz0zz2z\
  z4zz4zz4zz4zz6zz6zz6wz6tz7qz7pz7mz7kz7kz9<2>kz9nzBqz\
  BtzBwzBzzDzzDzzDzzDzzBzzD<5>zzEzzEzzEzzG<6>zzHzzHzzJ\
  <2>zzJzzJzzL<6>zzMzzMzzO<3>zzOzzSzzz
  }

frm:MandelbrotBC = { ; Z = Z^E + C
  e=p1
  p=real(p2)+PI
  q=2*PI*trunc(p/(2*PI))
  r=real(p2)-q
  Z=C=Pixel:
    Z=log(Z)
    IF(imag(Z)>r)
      Z=Z+flip(2*PI)
    ENDIF
    Z=exp(e*(Z+flip(q)))+C
  |Z|<100
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Ralph Feltens <[e-mail]>
Subject: Re: (fractint) FOTD  01-11-00  (Old Gold Minibrot [4])
Date: 02 Nov 2000 13:27:53 +0100

<!doctype html public "-//w3c//dtd html 4.0 transitional//en">
<html>
Hi there
<p>I'm just another one of those people that after years of using fractint
were lured to Ultrafractal and its layering capabilities. IMO, layering
per se is not a sufficient reason to reject the resulting picture as not
being a fractal any more. For as long as you are using the same formula
and coordinates for all of the layers, the underlying fractal shape will
stay invariant.
<p>The use of different coloring (& layering) algorithms, of course,
can lead to remarkably diverse results. But if you felt so inclined, you
would still be able to reproduce the fractal by using a single coloring
algorithm (probably a quite complex one) in a single layer image à
la fractint (missing true color support or other limitations that are program-
but not fractal-specific not being taken into consideration). So the use
of layering techniques should not be irreconcilable with "fractal purism".
<p>There are always some arbitrary choices to be made when generating a
fractal, even a simple one in fractint: choice of colormap, spread of the
colormap (e.g. log mapping), bailout radius (effects the position of the
color bands). Not to speak of the choices nessessary to generate one of
the beautiful orbit type fractals made popular by <a href="http://members.home.net/mbfractals/">Paul
Carlson</a> ...
<p>Regards
<p>Ralph Feltens
<p>PS. Somebody on this list (was it Jim Muth?) already stated the fact
that all we see is not a fractal, but the image of a fractal ...
<p>David Jones wrote:
<blockquote TYPE=CITE>On  1 Nov 00 at 7:26, Jim Muth wrote:
<p>> Since the more artistic fractalists remain satisfied
<br>> calling the images they produce fractals, I will
<br>> change the description of my images from fractals to
<br>> classic fractals.
<p>Wrong choice. *real* fractals. IMHO, fractal images using
<br>layering et al - whether or not the layering is done in
<br>the fractal generator or in a separate program - are
<br>post-processed, and no longer fractals to me.</blockquote>
</html>


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: <[e-mail]>
Subject: Re: (fractint) FOTD  01-11-00  (Old Gold Minibrot [4])
Date: 03 Nov 2000 12:16:44 +1300

Ralph Feltens <[e-mail]> said:

> <p>There are always some arbitrary choices to be made when generating a
> fractal, even a simple one in fractint: choice of colormap, spread of the
> colormap (e.g. log mapping), bailout radius (effects the position of the
> color bands). Not to speak of the choices nessessary to generate one of
> the beautiful orbit type fractals made popular by <a
href="http://members.home.net/mbfractals/">Paul
> Carlson</a> ...
>
Having seen some of the par files that Ultra Fractal uses, it seems that
"arbitrary choices" make up the vast bulk of the task - layering/compositing,
colouring, etc., but where's the fractal declared?

Morgan L. Owens
"The Gimp uses smaller scripts"

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Fernando Bresslau" <[e-mail]>
Subject: Re: Midgets - Re: (fractint) FOTD  29-10-00  (The Green Goblet [5])
Date: 02 Nov 2000 23:41:03 -0200

Thanks for the answers. yes, I was meaning the small mandelbrot copies in
the z^something + c fractal. Actually, the mandelbrotmix4, which is a
generalization of the previous formula. It happens sometimes that you hit on
a fractal (by choosing the exponents and multipliers in the formula) that
has lots of midgets quite visible and obvious. Other times that┤s isn┤t
true. In some cases you get an unconnected set, others the seems to be
conected, but hasn┤t midgets, not even deformed ones.
the mm4 formula is nice because it initializes the pixels (I think) in a way
that we get undeformed midgets.
So the question was which is the condition to the existence of midgets (even
deformed ones) and I add now another one: when does a set get diconected?
maybe it would be good to concentrate the analysis to the mm4 formula, which
is namely
z=k*((a*(z^b))+(d*(z^f)))+c

being k, a, b, c, f the parameters at the z screen.

Tahnks,
Fernando Bresslau


----- Original Message -----
Sent: Thursday, November 02, 2000 12:01 AM


> =?Windows-1252?B?UHVza+FzIElzdHbhbiBqci4=?= (if that is the writer's name)
> said:
> > >What is necessary for an image to have midgets? should the power o Z be
> > >greater than 2??
> >
> In the dynamic? As in z^2+c? I guess you mean "greater than or equal to
2".
> Lemme just switch to Fractint for a sec...
>
> Well, I found a recognisable Mandelbrot midget - a slightly nicked
z^2+c-like
> one - in z^1.9+c.
>
> > Are 'midgets' the smaller Mandelbrot-shapes in the main Mandelbrot-set
and
> > the small 'clones' in other sets?
> >
> Yes; also called "minibrots" or sometimes "atoms".
>
> > If yes:
> > I think that the iteration should be trapped with some starting values
(the
> > value of 'Z' should settle to a low value, instead of increasing toward
> > infinity). The Mandelbrot-set and the 'connected' Julia-sets have this
> > behaviour, the 'unconnected' Julia-sets and some other formulas -
> > type=sierpinski, type=unity - don't. This may depend on the exponent in
use
> > for some formulas.
> >
> The Mandelbrot Set and its Julia sets are defined by this property (z's
being
> bounded in magnitude): points within the set lead to bounded orbits,
orbits
> starting from points outside diverge towards infinity. In "unconnected"
Julias
> (or "dusts"), the set is - what topologists would call - of measure zero,
> which is to say that the points of the set are isolated from each other.
At
> any finite resolution, therefore, all you see are points _outside_ the
set.
>
> In the Unity fractal, the set is the unit circle (hence the name): the
fractal
> fun & games is a consquence of the method for finding it.
>
> I leave Sierpinski's gasket as an exercise for the reader.
>
> None of this really helps in determining when (and where) midgets should
> occur: the question gets even harder when you consider that some of these
> midgets (an infinite number, in fact - nay, the vast majority) are so
badly
> distorted that they're often unrecognisable.
>
> Morgan L. Owens
> "Lesser fleas."
>
> --------------------------------------------------------------
> Thanks for using Fractint, The Fractals and Fractint Discussion List
> Post Message:   [e-mail]
> Get Commands:   [e-mail] "help"
> Administrator:  [e-mail]
> Unsubscribe:    [e-mail] "unsubscribe fractint"


_________________________________________________________
Do You Yahoo!?
Get your free @yahoo.com address at http://mail.yahoo.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: (fractint) Re: Meteor
Date: 02 Nov 2000 20:39:42 EST

Cool image. I can hear the "disaster" music from Armageddon when I see it...
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: (fractint) A remark on fractal "purity"
Date: 02 Nov 2000 20:43:45 EST

Purity is clearly not a black and white distinction. Some would say that
only the spare elegance of boundary scan/MIIM/distance estimator images are
truly pure. Others include heavily post-processed images whenever the basic
fractal image is enhanced rather than obfuscated or mutilated by the
post-processing. I'd say it's a continuum, but that it's reasonably pure as
long as the basic fractal is clear -- for example in some of the images I've
experimented with recently, including anti-aliased images (done by making
large images in D&C mode and resampling in Corel Photo-Paint) and truecolor
images (I make three separate greyscale images, with different logmap
settings, and use Corel's Combine Channels option to merge them as the red,
green, and blue components of the result). The results look pretty "pure" to
me...
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) Classic FOTD 03-11-00 (Ionized Mandelbrot [7])
Date: 02 Nov 2000 23:33:38 -0500 (EST)


Classic FOTD -- November 03, 2000 (Rating 7)

Fractal visionaries and enthusiasts:

Today's striking fractal was created by a rather unusual formula
-0.002*(Z^1000)+0.02*(Z^(-2))+(1/C).  The parameters were chosen
entirely at random, as are the parameters for nearly all my
fractals.

I named the image "Ionized Mandelbrot" because of the fuzzy,
purplish-blue aura around the midget, which reminds me of the
ionized glow in a vacuum tube.  Since the picture is better than
the past few days' efforts, I rated it an above-average 7 on my
0-to-10 scale of fractal worth.

A day or so ago, a message was posted to the Fractint list,
asking what was necessary for a fractal to have midgets.  The
truth is that after working with the MandelbrotMix4 formula for
over a year, I just don't know.  To begin, it is difficult to
define exactly what a midget is.  Many fractals are filled with
holes that I do not consider midgets.  By a 'midget' I usually
mean a tiny, often distorted, classic Mandelbrot shape embedded
in a larger fractal.  These tiny Mandelbrot shapes are sometimes
called 'atoms'.

The easiest answer would be that midgets are present in all
fractals of the form Z^n+C, where 'n' is greater than 1 and Z is
initialized at the critical point of the formula.  But the
midgets are almost impossible to find in fractals where 'n' is
less than 1.2.  As 'n' is increased to higher values, the
midgets become easier to find, but ever less interesting,
eventually degenerating into boring lopsided circles.

The M-Mix4 formula automatically initializes Z to a critical
point of the iterated formula, but not all formulae have
midgets, and in many other fractals only certain limited parts
have midgets.  I have much more to discover about when and where
midgets

I'll return to the topic of midgets in a day or two.  For now
it's time to give a reminder that today's image takes 8 minutes
to render from the parameter file, and only a minute or so to
download from:

          <alt.binaries.pictures.fractals>

or from:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today was perfect, with sunny skies and a
temperature of 68F (20C), which lured the fractal cats onto the
porch and then into the yard, where they sampled the cat-mint
plant.

The philosophy is still sleeping, but I've got a few hours to go
yet in my day.  It's just enough time to find a fractal and
catch up on the fractal-art list, which has suddenly come alive.
Until tomorrow, take care, and do fractals exist as real objects,
or are they mere thoughts -- or are they both?


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Ionized_Mandelbrot { ; time=0:08:08.58 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=+7.625829827008553/+0.00937269972207/3.58\
  9962e+011/1/129.992/0.007 params=1/1000/-10/-2/-1.00\
  2/5000 float=y maxiter=1400 inside=0
  logmap=168 periodicity=10
  colors=000805A07C08D0CF0DG0FI0IJ0JL0L<5>L0eL0hL0k<3>\
  L1yL2zL2zL4zLOzDUzKYz0az0hz0oz0pz0ps1np<2>FehJceO`a<\
  3>dPQhMOkJLnIOoGQpGTrFWsDZuDaxCdyCgzAiz8l<2>z7uy4lr1\
  e<3>T0AM01G00I00J00J02L04M07M0AO0CO0FP0IQ0JQ0MS0PS0Q\
  W0TZ0Vc1We4Zi5`l7apAdsCexDgzGizIkzJlzLn<3>yWevZcsaap\
  dZngYkiVhlTeoQcrP`uMYxLWzJVvMVrPVnQTkTTgVTcYSZ`SWaSS\
  dQOeQJhQGiPM`OQZMWYM`WQWV<3>lFPTLOQMPOOSLPVGSQDTOAVJ\
  7WG2ZD0`80a50c20hA0lI<2>0ya<2>0zv0zz0zz0zy0xy0py0iy0\
  cy0Wy0Px0Ox<3>0Qx0Vr<3>0ha0lY0oT0sO0xJ0zF<2>0z10z00z\
  41zA4zGAzM<2>OydSviWuh`xg<3>pnauk`yhZzF0<2>n1Mi0Ve0a\
  c0hh0en4csC`xJYzQVzYSzdQ<2>zhOziOzkM<2>yoLvpMsrOrsPo\
  uQlvSkxThyTgzVdzWazY`zZYz`Wz`szGzz0zz1zz5zzAzzFzzI<2\
  >yzVvzYuzarzepziozlrzh<3>xzSyzOzzJ<3>zz14z05z17z2
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Baerbel Strauch" <[e-mail]>
Date: 03 Nov 2000 08:42:35 CET

hi there,
i┤m a big admirer of the fractal-art and i love your page...i would like to
know:
is there a beginners manual for working with/on fractals; some explanations
, photographs, webpages... i┤m also intetested in books.
i┤d love to create my own fractals!
thank u,
           bΣrbel
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Paul N. Lee" <[e-mail]>
Subject: (fractint) Re:
Date: 03 Nov 2000 01:56:51 -0600

BΣrbel Strauch wrote:
>
> hi there,
> i┤m a big admirer of the fractal-art and i love
> your page...i would like to know:
> is there a beginners manual for working with/on
> fractals; some explanations, photographs, webpages...
> i┤m also intetested in books.
> i┤d love to create my own fractals!
> thank u,
>
+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++

SHORT AND SIMPLE:  The fractal related newsgroups, discussion lists, and
websites get a lot of requests regarding fractal information.  The
following is by no means an exhaustive listing.  (For the exhaustive
list see the next section of this document.)  Just below is a listing of
a few of the programs (some freeware; some shareware) frequently used by
persons posting to the newsgroup.

Flarium/Iterations/Tiera-Zon/Sterling-ware/and others....
http://www.eclectasy.com/Iterations-et-Flarium24/
(mirror) http://www-hs.iuta.u-bordeaux.fr/ferguson/

Fractal ViZion/Fractal ZPlot/and others....
http://www.geocities.com/SoHo/Lofts/5601/

Fractint
http://spanky.triumf.ca/www/fractint/

Fractal eXtreme
http://www.cygnus-software.com/

Fractal Orbits 32
http://spanky.triumf.ca/pub/fractals/programs/ibmpc/windows/fo32201.zip

UltraFractal
http://www.ultrafractal.com/


For the MAC:
  FracPPC & Fractal Domains
     http://www.fractaldomains.com/
other MAC programs:
  http://hypertextbook.com/chaos/92.shtml
  http://spanky.triumf.ca/pub/fractals/programs/MAC/
  http://iq.tvsoft.com/~dplatt/mac/
  http://www.swin.edu.au/astronomy/pbourke/


+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++

For an exhaustive list of fractal generators, galleries featuring
fractals, and other fractal related information, go to the following:

    http://home.att.net/~Paul.N.Lee/Fractal_Software.html
and
    http://home.att.net/~Paul.N.Lee/Fractal_Links.txt
and
    http://home.att.net/~Paul.N.Lee/Fractal_Census.html

+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++


Sincerely,
P.N.L.
http://www.fractalus.com/cgi-bin/theway?ring=fractals&id=43&go

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Fernando Bresslau" <[e-mail]>
Subject: (fractint) Re:
Date: 03 Nov 2000 10:08:02 -0200

Hi, BΣrbel. I myself work mostly with two programs: fractint and
Ultrafractal. Both of them have nice webpages, with lots of info, including
for beginners. So I sugggest you take a look at  www.fractint.org and
www.ultrafractal.com where you will find links to downloads of the programs
and to resources, tutorials and goodies for beginners.
Thak you for your interest,
Fernando Bresslau
http://www.fractal.art.br

----- Original Message -----
Sent: Friday, November 03, 2000 6:42 AM


> hi there,
> i┤m a big admirer of the fractal-art and i love your page...i would like
to
> know:
> is there a beginners manual for working with/on fractals; some
explanations
> , photographs, webpages... i┤m also intetested in books.
> i┤d love to create my own fractals!
> thank u,
>            bΣrbel
> _________________________________________________________________________
> Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.
>
> Share information about yourself, create your own public profile at
> http://profiles.msn.com.
>
>
> --------------------------------------------------------------
> Thanks for using Fractint, The Fractals and Fractint Discussion List
> Post Message:   [e-mail]
> Get Commands:   [e-mail] "help"
> Administrator:  [e-mail]
> Unsubscribe:    [e-mail] "unsubscribe fractint"


_________________________________________________________
Do You Yahoo!?
Get your free @yahoo.com address at http://mail.yahoo.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Fernando Bresslau" <[e-mail]>
Subject: Re: (fractint) Classic FOTD 03-11-00 (Ionized Mandelbrot [7])
Date: 03 Nov 2000 10:17:19 -0200

Thanks, Jim, for the nice answer and for the nice midget... I┤ll start
iterating formulas with z┤s bigger than 1.5, maybe a lot bigger, like
1e20...
Fernando Bresslau
http://www.fractal.art.br



----- Original Message -----
Cc: <[e-mail]>
Sent: Friday, November 03, 2000 2:33 AM


>
> Classic FOTD -- November 03, 2000 (Rating 7)
>
> Fractal visionaries and enthusiasts:
>
> Today's striking fractal was created by a rather unusual formula
> -0.002*(Z^1000)+0.02*(Z^(-2))+(1/C).  The parameters were chosen
> entirely at random, as are the parameters for nearly all my
> fractals.
>
> I named the image "Ionized Mandelbrot" because of the fuzzy,
> purplish-blue aura around the midget, which reminds me of the
> ionized glow in a vacuum tube.  Since the picture is better than
> the past few days' efforts, I rated it an above-average 7 on my
> 0-to-10 scale of fractal worth.
>
> A day or so ago, a message was posted to the Fractint list,
> asking what was necessary for a fractal to have midgets.  The
> truth is that after working with the MandelbrotMix4 formula for
> over a year, I just don't know.  To begin, it is difficult to
> define exactly what a midget is.  Many fractals are filled with
> holes that I do not consider midgets.  By a 'midget' I usually
> mean a tiny, often distorted, classic Mandelbrot shape embedded
> in a larger fractal.  These tiny Mandelbrot shapes are sometimes
> called 'atoms'.
>
> The easiest answer would be that midgets are present in all
> fractals of the form Z^n+C, where 'n' is greater than 1 and Z is
> initialized at the critical point of the formula.  But the
> midgets are almost impossible to find in fractals where 'n' is
> less than 1.2.  As 'n' is increased to higher values, the
> midgets become easier to find, but ever less interesting,
> eventually degenerating into boring lopsided circles.
>
> The M-Mix4 formula automatically initializes Z to a critical
> point of the iterated formula, but not all formulae have
> midgets, and in many other fractals only certain limited parts
> have midgets.  I have much more to discover about when and where
> midgets
>
> I'll return to the topic of midgets in a day or two.  For now
> it's time to give a reminder that today's image takes 8 minutes
> to render from the parameter file, and only a minute or so to
> download from:
>
>           <alt.binaries.pictures.fractals>
>
> or from:
>
>           <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>
>
> The fractal weather today was perfect, with sunny skies and a
> temperature of 68F (20C), which lured the fractal cats onto the
> porch and then into the yard, where they sampled the cat-mint
> plant.
>
> The philosophy is still sleeping, but I've got a few hours to go
> yet in my day.  It's just enough time to find a fractal and
> catch up on the fractal-art list, which has suddenly come alive.
> Until tomorrow, take care, and do fractals exist as real objects,
> or are they mere thoughts -- or are they both?
>
>
> Jim Muth
> [e-mail]
>
>
> START 20.0 PAR-FORMULA FILE================================
>
> Ionized_Mandelbrot { ; time=0:08:08.58 -- SF5 on a P200
>   reset=2001 type=formula formulafile=critical.frm
>   formulaname=MandelbrotMix4 function=recip passes=1
>   center-mag=+7.625829827008553/+0.00937269972207/3.58\
>   9962e+011/1/129.992/0.007 params=1/1000/-10/-2/-1.00\
>   2/5000 float=y maxiter=1400 inside=0
>   logmap=168 periodicity=10
>   colors=000805A07C08D0CF0DG0FI0IJ0JL0L<5>L0eL0hL0k<3>\
>   L1yL2zL2zL4zLOzDUzKYz0az0hz0oz0pz0ps1np<2>FehJceO`a<\
>   3>dPQhMOkJLnIOoGQpGTrFWsDZuDaxCdyCgzAiz8l<2>z7uy4lr1\
>   e<3>T0AM01G00I00J00J02L04M07M0AO0CO0FP0IQ0JQ0MS0PS0Q\
>   W0TZ0Vc1We4Zi5`l7apAdsCexDgzGizIkzJlzLn<3>yWevZcsaap\
>   dZngYkiVhlTeoQcrP`uMYxLWzJVvMVrPVnQTkTTgVTcYSZ`SWaSS\
>   dQOeQJhQGiPM`OQZMWYM`WQWV<3>lFPTLOQMPOOSLPVGSQDTOAVJ\
>   7WG2ZD0`80a50c20hA0lI<2>0ya<2>0zv0zz0zz0zy0xy0py0iy0\
>   cy0Wy0Px0Ox<3>0Qx0Vr<3>0ha0lY0oT0sO0xJ0zF<2>0z10z00z\
>   41zA4zGAzM<2>OydSviWuh`xg<3>pnauk`yhZzF0<2>n1Mi0Ve0a\
>   c0hh0en4csC`xJYzQVzYSzdQ<2>zhOziOzkM<2>yoLvpMsrOrsPo\
>   uQlvSkxThyTgzVdzWazY`zZYz`Wz`szGzz0zz1zz5zzAzzFzzI<2\
>   >yzVvzYuzarzepziozlrzh<3>xzSyzOzzJ<3>zz14z05z17z2
>   }
>
> frm:MandelbrotMix4 {; Jim Muth
> a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
> g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
> k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
> z=k*((a*(z^b))+(d*(z^f)))+c,
> |z| < l
> }
>
> END 20.0 PAR-FORMULA FILE==================================
>
>
> --------------------------------------------------------------
> Thanks for using Fractint, The Fractals and Fractint Discussion List
> Post Message:   [e-mail]
> Get Commands:   [e-mail] "help"
> Administrator:  [e-mail]
> Unsubscribe:    [e-mail] "unsubscribe fractint"


_________________________________________________________
Do You Yahoo!?
Get your free @yahoo.com address at http://mail.yahoo.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Barry N. Merenoff" <[e-mail]>
Subject: Midgets - Re: (fractint) FOTD  29-10-00  (The Green Goblet
Date: 03 Nov 2000 13:38:24 -0500

Message text written by INTERNET:[e-mail]
>I think that the iteration should be trapped with some starting values<

That's an interesting idea. Could you please elaborate on it? Or maybe se=
nd
a sample Par?

Sincerely,
        Collin

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Barry N. Merenoff" <[e-mail]>
Subject: Re: Midgets - Re: (fractint) FOTD  29-10-00  (The Green
Date: 03 Nov 2000 14:13:01 -0500

Message text written by INTERNET:[e-mail]
>In "unconnected" Julias =

(or "dusts"), the set is - what topologists would call - of measure zero,=
 =

which is to say that the points of the set are isolated from each other.<=


Not quite. A dust has a "topological dimension" of zero. A connected Juli=
a
has a topological dimension of one, and a fractal with a decorated interi=
or
has a topological dimension of two. Note that the topological dimension i=
s
always an integer, and is not the quantity usually referred to as
dimension. That usual quantity is the Hausdorff dimension, which is alway=
s
greater than the topological dimension, and may be fractional. The measur=
e
of a fractal is in units of length to the power of the Hausdorff dimensio=
n.

For example, the Sierpinski Gasket has a topological dimension of 1 and a=

Hausdorff dimension of 1.585. The measure is proportional to the 0.7925
power of the bounding triangle's area.

The Mandelbrot Set, with a solid-color fill, has a topological dimension =
of
1 and a Hausdorff dimension of 2, but its measure is zero. Because the
topological dimension is 1, the measure includes only the boundary, not t=
he
interior. A Hausdorff dimension of 2 indicates that the measure is in
ordinary units of area. This means that the boundary forms structures tha=
t
appear to be filled in with a boundary-only area, but which when magnifie=
d
are always seen to be merely a curve.

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Barry N. Merenoff" <[e-mail]>
Subject: Re: (fractint) Fractal Geometry Summer Workshop
Date: 03 Nov 2000 14:19:46 -0500

Message text written by INTERNET:[e-mail]
>The book "Turbulent Mirror" has a very good discussion =

and explanation of fractals that would be very good for =

newbies to fractals.
<

I thought "Turbulent Mirror" was too philosophical. "Fractals Everywhere"=

sticks more to the subject.

Sincerely,
        Collin

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Barry N. Merenoff" <[e-mail]>
Subject: Re: (fractint) FOTD  01-11-00  (Old Gold Minibrot [4])
Date: 03 Nov 2000 14:27:57 -0500

Message text written by INTERNET:[e-mail]
>but where's the fractal declared?<

Mathematically speaking, the actual fractal is an abstract concept.
Different choices of rendering the same formula are technically the same
fractal.

Sincerely,
        Collin

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) Classic FOTD 04-11-00 (Fractally Exciting [8])
Date: 03 Nov 2000 19:35:25 -0500 (EST)


Classic FOTD -- November 04, 2000 (Rating 8)

Fractal visionaries and enthusiasts:

There's a lot of fractal in today's classic fractal, so much
fractal in fact that I found the image fractally exciting.  I
named the picture accordingly, and rated it an outstanding 8.

Once again I unwrapped the MandelbrotMix4 formula to search for
my CFOTD.  The exact fractal formula that was iterated to
produce the rather spectacular midget is 0.1Z^(-1000)+Z^2+(1/C).
The escape radius is 100.

As do all fractals, the image has detail beyond limit.  But this
fractal exceeds even the expected detail.  Rarely have I seen
such a variety of color and detail in a fractal, especially a
one-layer image rendered with the usual flat equal-iteration
bands and inside=0.  Of course, I revved up the colors a small
amount in a graphic program, but the processed color palette has
been incorporated into the parameter file, so regardless of
whether one downloads the GIF image from:

          alt.binaries.pictures.fractals

or from:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

or renders it directly from the attached parameter file, the
image will display the full range of colors.

Since the parameter file takes almost 18 minutes to render on a
200mhz Pentium, the download is the wiser choice.

The fractal weather today was once again perfect.  The high
temperature reached 73F (23C), which made both the cats and me
happy.  The philosophy is still stagnated, waiting until my muse
returns.

Regardless of whether the muse returns tomorrow, I shall return
with another fractal and a few words to go along with the
fractal.  For now, the day's work is done, and it's time to
settle down for a relaxing evening in front of the TV,
especially with a junky old movie or two showing.

Until tomorrow, take care, and don't count your fractals until
they're rendered.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Fractally_Exciting { ; time=0:17:51.43 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=-177.609990921166/+0.03714106316788/2.283\
  007e+008/1/-127.499/0.004 params=0.1/-1000/1/2/0/0
  float=y maxiter=2000 inside=0 logmap=329 periodicity=9
  colors=000pgzwnzzuzwrurprmnngmkbif_gbVf_PdXKaR<2>7XH\
  CRGGMEKJCOEBRB9VEBXGCYJE_KGaMHdPJfRKgTMiXOkYPm_RnVXp\
  PapMdrHisCns9rp6nm4mi2kf1ib0g_0d<2>P0_M0YK0XJ0TH2RGB\
  PGHOEPMCXKBdJBkH9fG7bE7_C6XC4TB4P92M72J74O66R66V47_4\
  7b49f2Bi2Bn1Cr1Cu1Ey0Gz0<2>Hz0Mz1Pz2Tu6Xp7_i9bdCf_Ei\
  TGmOJpHK<2>z1Rz0Tz0Yy0au1fs2ir4mn6rm7ui9zgBzfCziJsmP\
  fpXTrdHn`EkYBgT9fR6bP4_N1XL0VJ0RH0OG0KD0JB0G90C60D50\
  EC0GE0JE0KG0MG2PH7RHCVJHXJMYKRaKXbMadMfgYdkidmsdigOg\
  X9fK0aO0YR0TV2PY4Ma7Hd9EgCBkE6nH2rJ0sKya7pXCgRG_MJTH\
  MKCRC7V42Y00a24d79f<2>KPmPVpTar<2>fpy_spTwgMy_GzRBzK\
  EyJHsHKnGOiGRfEVaCYXBaRByM9BJ7gE6n96r44u02y02nM1dk0X\
  z0dz2ky6rsBymEzgJzbMzYP<2>zX6yX0yYCyYOy__y_kyawyazya\
  zpbz<3>OizHkz9mz2nz0nyYMzz0zr7zbJuOXp7gk0uf0zb0zYGuV\
  YpR_uXay_<3>gzrkzknzfpzaszVwzPyzKzzGzz9zz4zz0<2>zz0T\
  zzYzzdzzkzz
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "David Jones" <[e-mail]>
Subject: Re: (fractint) Fractal Geometry Summer Workshop
Date: 03 Nov 2000 20:02:51 -1000

On  3 Nov 00 at 14:19, Barry N. Merenoff wrote:

> Message text written by
> INTERNET:[e-mail]
> >The book "Turbulent Mirror" has a very good discussion
> and explanation of fractals that would be very good for
> newbies to fractals. <
>
> I thought "Turbulent Mirror" was too philosophical.
> "Fractals Everywhere" sticks more to the subject.

It is, particularly later on. But the explanation of
who a fractal is and how they are made is very
accessible.

Another blast of bits from David
http://home.hawaii.rr.com/aliasjj/   http://www.hawastsoc.org/
For the best Hawaii & Pacific Basin surf forecast:
    http://www.surfreporthawaii.com

Random Thought for this Nanosecond
Welfare is a class for Liberal Arts majors. (D.Jones)



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: (fractint) Re:
Date: 04 Nov 2000 01:55:46 EST

>i┤m a big admirer of the fractal-art and i love your page...i would like to
>know:
>is there a beginners manual for working with/on fractals; some explanations
>, photographs, webpages... i┤m also intetested in books.
>i┤d love to create my own fractals!

I suggest downloading Fractint
(http://spanky.triumf.ca/www/fractint/fractint/html IIRC) and browsing its
online help.
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "David Jones" <[e-mail]>
Subject: Re: (fractint) Fractal Geometry Summer Workshop
Date: 03 Nov 2000 22:14:56 -1000

On  3 Nov 00 at 20:02, David Jones wrote:

> It is, particularly later on. But the explanation of who
> a fractal is and how they are made is very accessible.

Oh, dear! Now I have to wonder if fractal sets are
complex enough to develop intelligence! #-)


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Morgan L. Owens" <[e-mail]>
Subject: Re: Midgets - Re: (fractint) FOTD  29-10-00  (The Green Goblet
Date: 04 Nov 2000 21:47:39 +1300

At 14:13 03/11/2000 -0500, you wrote:
>Message text written by INTERNET:[e-mail]
> >In "unconnected" Julias
>(or "dusts"), the set is - what topologists would call - of measure zero,
>which is to say that the points of the set are isolated from each other.<
>
>Not quite. A dust has a "topological dimension" of zero. A connected Julia
>has a topological dimension of one, and a fractal with a decorated interior
>has a topological dimension of two. Note that the topological dimension is
>always an integer, and is not the quantity usually referred to as
>dimension. That usual quantity is the Hausdorff dimension, which is always
>greater than the topological dimension, and may be fractional. The measure
>of a fractal is in units of length to the power of the Hausdorff dimension.

If you're using a Hausdorff measure, that is - Lebesgue measure was what I
had in mind. Whether it was appropriate could be debated, but what I was
emphasising was that the Julia dusts themselves are never actually seen in
any rendering (the connected components of which always being to small to
be drawn), only their surroundings. So topological dimension was more
relevant than Hausdorff.

I shouldn't have said "isolated", it is true - I should have said
"disconnected".

>The Mandelbrot Set, with a solid-color fill,

Just say "the boundary of the Mandelbrot set" :-)

>has a topological dimension of 1 and a Hausdorff dimension of 2...

>This means that the boundary forms structures that
>appear to be filled in with a boundary-only area, but which when magnified
>are always seen to be merely a curve.

But still appears to fill an entire area even when magnified.

Morgan
"My rust is flaking"


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Fernando Bresslau" <[e-mail]>
Subject: Re: Midgets - Re: (fractint) FOTD  29-10-00  (The Green Goblet [5])
Date: 04 Nov 2000 11:22:50 -0200

Look at today┤s FotD. If you watch the formula, you┤ll see that something is
done to z before it is used in the formua. that┤s the initialization, and if
I understood it correctly, it ensures that the midgets found in the fractal
aren┤t distorted..
Fernando Bresslau

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b),

 *****z=(-a*b*g*h)^j,*****

k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}


----- Original Message -----
Sent: Friday, November 03, 2000 4:38 PM


Message text written by INTERNET:[e-mail]
>I think that the iteration should be trapped with some starting values<

That's an interesting idea. Could you please elaborate on it? Or maybe send
a sample Par?

Sincerely,
        Collin

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


_________________________________________________________
Do You Yahoo!?
Get your free @yahoo.com address at http://mail.yahoo.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Barry N. Merenoff" <[e-mail]>
Subject: Re: Midgets - Re: (fractint) FOTD  29-10-00  (The Green
Date: 04 Nov 2000 09:37:50 -0500

Message text written by INTERNET:[e-mail]
>that=B4s the initialization, and if
I understood it correctly, it ensures that the midgets found in the fract=
al
aren=B4t distorted..<

That's something I've never understood about MandelMix4. I thought that t=
he
best initialization is one which makes the derivative of the iteration
zero. The initialization in MandelMix4 makes the derivative of the
iteration
z*k*(a*b*z^b+d*f*z^f)
I don't understand the significance of this value.

Sincerely,
        Collin

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "=?ISO-8859-1?B?UHVza+FzIElzdHbhbiBqci4=?=" <[e-mail]>
Subject: Re: (from Barry N. Merenoff) Midgets - Re: (fractint) FOTD  29-10-00  (The Green Goblet [5])
Date: 04 Nov 2000 22:24:06 +0100

>>I think that the iteration should be trapped with some starting values

>That's an interesting idea. Could you please elaborate on it? Or maybe send
>a sample Par?


I mean that with some starting values, the value of the iterated variable
should stay 'trapped' below a low value. That appears in the inside part of
the Mandelbrot-set, the inside of a connected Julia-set, the zero area
points of an unconnected Julia-set. In these cases, |Z| never exceeds 4.
That's nothing new.



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Jonathan Osuch" <[e-mail]>
Subject: (fractint) Fractint Version 20.1 patch 2
Date: 04 Nov 2000 20:03:22 -0600

All,

The executable for patch 2 to version 20.1 is now available as fradev.zip
at:

    http://www.fractint.org/ftp/

Here's what's new:

Removed the changes to the savegraphics() and restoregraphics() routines
made in patch 1.  The changes were causing corrupted images with some
resolutions and video adapters.

Updated Bret Mulvey's email address.

Jonathan



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) Classic FOTD 05-11-00 (The next Fractal [6])
Date: 04 Nov 2000 21:45:55 -0500 (EST)


Classic FOTD -- November 05, 2000 (Rating 6)

Fractal visionaries and enthusiasts:

Today's fractal features the next midget in an apparently
endless series of midgets, which is reason enough to name the
picture "The Next Midget".  Yes, I realize that a name such as
"The Final Midget" or "Dancing Midget" would be more poetic, but
I was not trying to be a poet.  I was simply trying to name a
fractal.

The bluish-gray picture, with its metallic appearance and broad,
intricate filaments, rates a 6, which is a little above average.
I gave the image just the slightest boost in a graphic program.
The graphic boost is included in the parameter file.

The expression behind the image, Z^(-14)+2.5Z^(-1.45)+(1/C), is
simple enough, and thanks to the wonder-formula MandelbrotMix4,
it produces a fractal filled with midgets.  BTW, I call the
M-Mix4 a wonder-formula because I wonder why it sometimes works
and other times fails to draw a fractal with midgets.

The MandelbrotMix4 formula has an interesting history, which I
may tell in one of these C-FOTD's.  But today is not the day.
It's Saturday evening and the time is near for my weekly
excursion into the world of junk TV.

With the parameter file having a render time of 1-1/2 minutes,
it's a toss-up whether to run the parameter file or to run to
Usenet at:

          <alt.binaries.pictures.fractals>

or to the Web at:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

and download the GIF image from there.

The fractal weather today was cloudy with a few tiny drops of
rain.  The temperature of 67F (19.5C) was un-notable.  The cats
failed to note it as they frolicked in the yard.

There's no philosophy today, but it's coming, so keep in touch.
You wouldn't want to miss out on the action when the philosophy
breaks.  Until next time, take care, and enjoy today's image.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

The_Next_Midget    { ; time=0:01:29.75 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip
  center-mag=-1.778683555482173/-0.5422446532818447/23\
  5454.1/1/-49.999 params=1/-14/2.5/-1.45/0/0 float=y
  maxiter=1200 inside=0 logmap=17 periodicity=10
  colors=000RQ_UTaWVdZYe`_gcajedlgfmjhplkrmmshhmeeha`d\
  ZY_VTVRPPOKKKHGHCAD86C99AAC9CG8CI7DL7EO6GQ5GU3HW2I_1\
  Ja1Jd<4>0PZ0QY0RY<3>0WT0YR0ZQ0ZQ5_RA_RH`RL`RRaRYaRaa\
  RgcRleRrgTxjTzkTwoUqrVkuWexW_zYUzZPzZKx`HqcDje9cf5Vh\
  1Ok0Hm09o0Gj3Ke<2>HZRLcI<3>cvegzkkzqgwvepyahz_azWVzU\
  OzQHzO9zK2zI0zH8zHKz<2>GuzGzzKzzOxzTuzWqz<3>lczq_zuW\
  z<2>IJz<2>W1z_0zV0zQ1z<3>7Cz2Ez0Hz0Jz2HzAEzJDzRAz<2>\
  o6z<3>sAzsCzuDz<3>xIzyJzzKzzKz<8>eVzcWz`Yz<2>U`zRazQ\
  `z<2>PZzOYzOWzNWzNVzLUzLUz<3>rTz<3>e_za`z_azWdzUez<3\
  >HkzDmzAoz7pz5qz9oz<7>aezedzhcz<3>wZzaRzHKz0Ez0Lz1Tz\
  <2>8mzAuzCzzJszQkzWczcVzjNzpGzhHzcIzYJzRKzLLzGNz9Oz3\
  Pz0PzEYzVdzkkzzrz<2>zNzzKz<2>zGzETzEQzGPzGNzHKzHJzIH\
  zIGz<2>POz
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Barry N. Merenoff" <[e-mail]>
Subject: Re: (from Barry N. Merenoff) Midgets - Re: (fractint) FOTD
Date: 05 Nov 2000 04:02:19 -0500

Do you know a procedure for finding the maximum value of |Z| for an
arbitrary formula?

Sincerely,
        Collin

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: [e-mail]
Subject: Re: (fractint) Beta version of new animation utility for Fractint available
Date: 05 Nov 2000 10:51:20 EST

Can this utility allow me to convert "color" cycled animations from the real
time Fractint into an AVI file?  I love color cycling and have been spending
my time learning to manipulate 256 color fractals.

Let me know.  Tom

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Rupert Millard" <[e-mail]>
Subject: Re: (fractint) Re: List of fractal programs by P.N.L.
Date: 05 Nov 2000 16:26:14 GMT

Paul,

>For an exhaustive list of fractal generators, galleries featuring
>fractals, and other fractal related information, go to the following:
>
>     http://home.att.net/~Paul.N.Lee/Fractal_Software.html


This is *very* helpful, there are lots of "exhaustive" / "definitive" lists
of fractal software out there:

http://www.geocities.com/arangas/index.html

http://www.eclectasy.com/fractovia/fractal_generators/fractals_freeware1.html

http://thinks.com/software/fractals.htm

& the ones on http://spanky.triumf.ca, http://www.fractalus.com etc.

but I've not yet seen one quite so "exhaustive" / "definitive" as yours!

Keep up the good work,

From,

Rupert

_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Paul N. Lee" <[e-mail]>
Subject: Re: (fractint) Re: List of fractal programs by P.N.L.
Date: 05 Nov 2000 11:56:41 -0600

Rupert Millard wrote:
>
> Paul,
>
> >For an exhaustive list of fractal generators, galleries featuring
> >fractals, and other fractal related information, go to the following:
> >
> >     http://home.att.net/~Paul.N.Lee/Fractal_Software.html
>
> This is *very* helpful,

Thank you so *much*!!  But the above link is not the "exhaustive" list
of software, nor does it claim to be.  The preceding sentence mentions
other areas of fractal concern like galleries, etc., and is also
followed by the following two additional links:

    http://home.att.net/~Paul.N.Lee/Fractal_Links.txt
    http://home.att.net/~Paul.N.Lee/Fractal_Census.html

The three combined URL, will make up the "exhaustive" list of most
things related to fractals.

>
> there are lots of "exhaustive" / "definitive"
> lists of fractal software out there:
> http://www.eclectasy.com/fractovia/fractal_generators/fractals_freeware1.html
>
> http://thinks.com/software/fractals.htm
>

Where do you think the above two originally got their information
from??  I gave Juan Luis permission back around July 05, 1999 to use
that information for his website.

>
> Keep up the good work,

Thank you again, and I hope to be able to continue doing so.

Sincerely,
P.N.L.
http://www.fractalus.com/cgi-bin/theway?ring=fractals&id=43&go

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Paul N. Lee" <[e-mail]>
Subject: (fractint) Fractals in Multimedia
Date: 05 Nov 2000 13:14:23 -0600

The Institute for Mathematics and Its Applications (located at the
University of Minnesota, Twin Cities Campus, in Vincent Hall) will be
having a "Minisymposium" concerning _Fractals in Multimedia_, scheduled
for January 17-19, 2001.

Some of the people involved are as follows:

    Michael Barnsley
    Steven Demko
    Ken Musgrave
    Heinz-Otto Peitgen
    and about 20 more...

Further information may be found at the following:

    http://www.ima.umn.edu/multimedia/winter/ms.html

Sincerely,
P.N.L.
http://www.fractalus.com/cgi-bin/theway?ring=fractals&id=43&go

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) Classic FOTD 06-11-00 (Abstraction 01 [7])
Date: 06 Nov 2000 00:12:53 -0500 (EST)


Classic FOTD -- November 06, 2000 (Rating 7)

Fractal visionaries and enthusiasts:

I appear to be on a roll.  One above-average fractal after
another keeps turning up.  In keeping with the trend, today's
image, which for lack of a better idea has been named
"Abstraction 01", rates an above-average 7.

The formula of today's scene is Z^1.03-Z^(-1.5)+(1/C).  The
calculation was once again done by the mysterious MandelbrotMix4
formula, which appears strange but produces midgets by the
thousands.

The parameter file finishes in 12-1/2 minutes on a reasonably
fast Pentium.  The image file downloads much faster from:

          alt.binaries.pictures.fractals

or from:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today was sunny but with puffy white clouds,
and a temperature of 57F (14C), which was barely warm enough for
the fractal cats.

I wish my philosophizing were doing as well as my fractal
searching.  Once again I failed to find the inspiration to
write.  But I'll try again tomorrow.  Until then, take care, and
what did we do with our idle time before fractals existed?


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Abstraction_01     { ; time=0:12:35.44 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=+0.24270803302426930/+4.39028735472479500\
  /265776.6/1/22.5 params=-1/-1.5/1/1.03/0/0 float=y
  maxiter=1800 inside=0 logmap=213 periodicity=10
  colors=000S4zT1z<2>Y0zb0zh0zX0z`0zS0zQ0wN0tM0qJ0nH0k\
  E0hD0eA0b80_50X40T10Q<2>00H00K11N<7>PQhSTkVXnY_q`ctc\
  fufixilz<2>ruzqozokzoezn`znVzlQzkKzkGziAzi5zkEzlNznX\
  zoexqnwut0qq0ln1hk2ch4_e4<2>MY8HVADSA<2>0JE0EB0HE<2>\
  0PJ0SK0TM0XN0_P0`Q<3>0kX0nY0o_<3>0ze<3>0zk0ze0x_2tT7\
  oP<3>PY2T_4X`5`b7cb7fc8keAneAqfBuhDxiEziEzkGzlHzlHzo\
  EtqBkrAbu7Tw4Kx2Bz02z00z00z00z0<3>1o01l02h0<3>8X0AT0\
  0b0EQ0MG0T40`00<2>w00z20z50<2>zE2wH5oK7iNAkQBkTElXGl\
  _JnbKneNohPokQkfT<4>XPhTMkQHn<3>E4z70zB1zG5xJAuNErSJ\
  oVNk_ShcXef`bke_oiVrnSwrPzwMzzJwwK<2>`iKeXJiKKn8HoBK\
  oEMoGPoJQoKSoNVoQXoS_oV`oXbo_eobfociofkohlkikfkkclk_\
  nkXoiSqiNriKtiGuhDwh8xh5zh8zfAzeDzcEzbHz`Jz_MzYNzYPz\
  XSzVTzTXzSYzQ`zPbzNczNfzMhzKkzJlzHozGqzEwzGrzEnzDPzz\
  Qzz
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Thore Berntsen <[e-mail]>
Subject: Re: (fractint) Beta version of new animation utility for Fractint available
Date: 06 Nov 2000 09:09:16 +0100 (CET)

[e-mail]
Content-Type: text/plain; charset=us-ascii
Content-Transfer-Encoding: 7bit

>
> Can this utility allow me to convert "color" cycled animations from the real
> time Fractint into an AVI file?  I love color cycling and have been spending
> my time learning to manipulate 256 color fractals.
>
> Let me know.  Tom
>
> --------------------------------------------------------------
> Thanks for using Fractint, The Fractals and Fractint Discussion List
> Post Message:   [e-mail]
> Get Commands:   [e-mail] "help"
> Administrator:  [e-mail]
> Unsubscribe:    [e-mail] "unsubscribe fractint"
>
>
> Yes it animates colors.
[e-mail]--


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: (fractint) Obscure case where diffusion gives poor estimates.
Date: 06 Nov 2000 04:13:59 EST


deep_1_54          {
                     ;  Version 2001 Patchlevel 1
  reset=2001 type=mandel passes=d
  center-mag=-0.74526321750669670/+0.11304138430272110/1.263809e+009/0.999\
  7 params=0/0 float=y maxiter=1048576 inside=0 outside=0 logmap=1122
  distest=-1/71/1024/768
  colors=zzz000<56>EEEEEEEEE<2>FFFFFFIII<7>fffjjjmmm<3>zzz<10>aaaZZZXXX<2>\
  QQQNNNNNN<157>zzz
  video=AF7 savename=frmig_54
  }

Diffusion on this one initially estimates 8 hours on a PII-400, but this
climbs to about 12 by the time it finishes.
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Morgan L. Owens" <[e-mail]>
Subject: Re: (from Barry N. Merenoff) Midgets - Re: (fractint) FOTD
Date: 06 Nov 2000 19:42:46 +1300

At 04:02 05/11/2000 -0500, Collin wrote:
>Do you know a procedure for finding the maximum value of |Z| for an
>arbitrary formula?

I strongly suspect that there no such procedure exists - that no matter
what procedure one may come up with, there will be formulae for which it
fails to give a (correct!) finite upper bound for |Z|.

Morgan L. Owens
"I have discovered a truly marvellous demonstration of this conjecture
which this .sig is too short to contain."


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 07-11-00 (Pi Fantasy [6])
Date: 06 Nov 2000 21:11:59 -0500 (EST)


Classic FOTD -- November 07, 2000 (Rating 6)

Fractal visionaries and enthusiasts:

Today's fractal is a slice of pie, or perhaps I should say pi.
The expression that was iterated to draw the image is Z^(pi)+C.
To add a bit of interest, I calculated the expression with the
MandelbrotBC formula, which draws the remote parts of the
infinite spiral of fractals with fractional exponents of Z.  To
keep with the 3.14159 theme, I also set the second parameter to
pi.

The parent fractal looks a lot like the Z^3+C Mandeloid fractal,
though it is crooked, and its west valley is split.  To see this
parent fractal, reset the logmap to 1 and back out of today's
image, which is located in the area where the west valley
broadens and splits.

Perhaps the most unusual feature of the image is the tattered
appearance of the features surrounding the midget, and the near
total lack of symmetry.  The midget itself, which closely
resembles the cubic Mandeloid, is surrounded by many other
midgets, none of them explored.

The attached parameter file takes 9-1/2 minutes to render on a
200mhz Pentium machine.  The download of the image from usenet
is far faster, that is if the image file makes it to your news
server.  The newsgroup in question is:

          <alt.binaries.pictures.fractals>

The image also will soon be posted to Paul Lee's web site at:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today was perfect, with blue skies un-marred
by the slightest trace of cloudiness, and a temperature of 56F
(13C), which so thrilled the fractal cats that they spent most
of the afternoon sleeping in the sun in their chairs on the
porch.

The philosophy went nowhere today, but it's time to shut down
Fractal Central and go somewhere myself.  Until next time, take
care, and be kind to your fractals.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Pi_Fantasy         { ; time=0:09:34.68 -- SF5 on a P200
  reset=2001 type=formula formulafile=branchct.frm
  formulaname=MandelbrotBC passes=1 center-mag=-0.3953\
  8899237559290/-0.08378373837276828/2244856
  params=3.14159265358979/0/3.14159265358979/0 float=y
  maxiter=3000 inside=0 logmap=169 periodicity=10
  colors=000IAIIAI<3>IGIJHIKII<3>PIIQIIRIITIIRII<3>QII\
  PIIPIIQIIQIIPHINCIK7CI03H07<3>H9HHCJGEN<3>GOWGQZETa<\
  3>EakEcmGalGakG`jG`h<3>GZeGYdGYdGWcGWa<3>GUZHTYHTWHR\
  W<2>HQTHPTHPR<2>HNOHNOHLNHLLHKKGJJ<8>JLKKLKKLKKNKLNK\
  LNKLNKNNK<8>QPKQPKQPK<2>RQKRQKTQK<5>VRKVRKVRKWRKWTKW\
  TKYTK<7>_UK`UK`VK<2>aVKaVK`WGaVIaVKcVLcUO<2>dTTeTVeT\
  YfRZfR`gRagQdgQehQghPjjPkjPmkOokOqjPr<2>lNvlNwmLxmLy\
  yKzoKz<5>rHzrHzrHzsGzsGzuEz<2>vDzvDzuGzuHzsJzsKzrLzr\
  OzqPzqQzpTzpUzoWzoYymZv<3>kegkfdjhejjghkjhmlgoogpphq\
  mhqljrkjrjjshksgkuf<3>mvamw`mw_oxZ<3>pzUqzTqzR<3>szN\
  szLszKuzJuzIwzIuzHszHqzHpzHozHlzHkzHhzH<3>czGazG_zGZ\
  zGazf<4>_zd
  }

frm:MandelbrotBC = { ; Z = Z^E + C
  e=p1
  p=real(p2)+PI
  q=2*PI*trunc(p/(2*PI))
  r=real(p2)-q
  Z=C=Pixel:
    Z=log(Z)
    IF(imag(Z)>r)
      Z=Z+flip(2*PI)
    ENDIF
    Z=exp(e*(Z+flip(q)))+C
  |Z|<100
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Andrew Coppin" <[e-mail]>
Subject: (fractint) FOTD
Date: 07 Nov 2000 13:29:25 GMT

Hi Jim.

I just wanted to say that "Abstraction 01" and "Excited Fractal" are both
really excellent!

Keep it up!

Andrew Coppin
"All elliptic equations are really modular forms."

_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 08-11-00 (Three Trees [5])
Date: 07 Nov 2000 21:56:52 -0500 (EST)


Classic FOTD -- November 08, 2000 (Rating 5)

Fractal visionaries and enthusiasts:

Today's fractal has no quadratic midgets.  I've been producing
almost nothing but such midgets lately, and it might be time for
a midget break.  Oh, there are several midgets in today's
picture -- one prominent one in the lower left quadrant, and
others scattered throughout the scene, but they are not the
usual quadratic midgets.

Instead of midgets, today's image features trees -- three trees
in fact, which is the name I gave to the picture.  I rated the
picture a 5, mostly because I was distracted by watching the
election returns, and gave too little effort to nursing my
fractal.

Yesterday's image featured the number known as the Greek letter
pi.  Today's fractal features the number known as the golden
ratio, which has a value of 1.618033989..., and which by a
strange coincidence happens to be the square root of 5, plus 1,
divided by 2.  To make the fractal doubly golden, I also entered
-1.618033989 into the MandelbrotBC formula as the second
parameter.

The parent fractal is a curious thing, an obvious Mandeloid
standing on its head, with much chaos and many filaments around
its main bay and rudimentary buds.  The trees of today's image
are located on the WSW shore of the bay, just below the second
discontinuity.  This parent fractal is filled with interesting
nooks and crannies, all of which deserve a more thorough
examination.  Perhaps I'll return to it for tomorrow's C-FOTD.

A benefit of an image with a magnitude as low as today's is that
it is fast.  The parameter file renders in only 26 seconds on a
Pentium-200.  On one of those 800mhz machines, it will finish in
10 seconds or so.  But if running the parameter file is too much
of a hassle, the GIF image file has been posted to the Usenet
binary newsgroup:

          <alt.binaries.pictures.fractals>

and before long it will also be available on Paul Lee's web site
at the URL:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today was surprisingly mild.  The
temperature of 64F (18C) and partly sunny skies lured the cats
outdoors, where they spent the afternoon lounging on the porch,
watching the insects hovering around the still-blooming
marigolds.

For all those waiting with bated breath for my next round of
fractal philosophy, there is nothing but disappointment.  I'm
sorry, but too much work combined with too much distraction left
nothing to act as inspiration.  So the philosophy will once
again be delayed, but eventually it will appear -- it always has
in the past.

For now however, I'm settling down to watch the election returns
to see how my guy makes out.  Until tomorrow, when depending on
the outcome, I'll be either pleased or disgruntled, take care,
and may your wisest wishes come true.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Three_Trees        { ; time=0:00:26.42 -- SF5 on a P200
  reset=2001 type=formula formulafile=branchct.frm
  formulaname=MandelbrotBC passes=t
  center-mag=0.163588/-1.36873/6.622925/1/-142.5
  params=1.618034/0/-1.618034/0 float=y maxiter=6000
  inside=0 logmap=4 periodicity=10
  colors=000F9gFIgFAjF3mO0pX7mcIllSisagzjfxVVuFLr0A70A\
  A79CD9FJ7GP77OMDGo0M`IFsVJLILV4LdQp0Ml7IgDDcL9`Q4XX0\
  Sc0OiXQzJOx6MszzOrySisV`m_SgaJadAXi1QlIOr9Mp0Lo0vfD0\
  T7zz4zy3zx1sv<3>0QpzxmjmoTcoAToGLy4LssJzjLzcLzVLzOLz\
  GLx7Lu0LrzXurVsiTs`SrSQrJPpAOp1MozzzLg_FcaA_d6Xg1Sj0\
  Omz0rz0pp0pd1pS6oGCo4GoXGgJIj6Jm9zJ0d_joYJ_f__zLTz6P\
  u0G00JL_TYSS`MQcGPfAOg4Mj0LmMjzFcy7Yv0Qrm0zL7v04009A\
  <2>0Id03z06z07z0Ay0Cx0Fu0Gs0JpyCLaFVFIdz7`yAclCfYFgL\
  Gj6JmMI0CJA1LVvvzPcul0zL3zQzxMzvIxuDrs9js4cr0Yp0Qo9m\
  06i03d91`I0XQ0S_0Og4Fx1Gv0Iu0Is0Jr0LpVvzIiz4Xx0Px0Ou\
  0Ms0Mr0LpOi4JdAFaGC_M7XS3TY0Qc0Oi60v04r0zm0zP0uX0ia0\
  XiVzVu7iiAj_ClPFlDGm3Jog0XQ4c9DiPmdLifGfgCai9_j4Vl0S\
  m0OoL_LFXQATV6S`1Pd0Mj00V06a0DiazVXzYQx`LrcFjd9cg3Yj\
  0Qm0zo0so0go0XofL0XL7MLJCLT1LdIm0Cg07aD1XQ0QcT9iiFzS\
  IzAJupP0cf0Ta0LYCATP1PalfF`aMPYTrJzuJz
  }

frm:MandelbrotBC = { ; Z = Z^E + C
  e=p1
  p=real(p2)+PI
  q=2*PI*trunc(p/(2*PI))
  r=real(p2)-q
  Z=C=Pixel:
    Z=log(Z)
    IF(imag(Z)>r)
      Z=Z+flip(2*PI)
    ENDIF
    Z=exp(e*(Z+flip(q)))+C
  |Z|<100
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "=?iso-8859-1?B?UHVza+FzIElzdHbhbiBqci4=?=" <[e-mail]>
Subject: (fractint) Re: Obscure case where diffusion gives poor estimates.
Date: 08 Nov 2000 18:16:11 +0100

>Diffusion on this one initially estimates 8 hours on a PII-400, but this
>climbs to about 12 by the time it finishes.


What is the mode assigned to AF7 in your CFG file? I had some ideas. (So far
I remember, the original CFG file had no mode assigned to ALT+F7, but
anyway, I don't have it :(  )




Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "=?iso-8859-1?B?UHVza+FzIElzdHbhbiBqci4=?=" <[e-mail]>
Subject: Value of |Z| (Re: (from Barry N. Merenoff) Midgets - Re: (fractint) FOTD  29-10-00  (The Green Goblet [5]))
Date: 08 Nov 2000 18:16:16 +0100

Try the 'inside=zmag' mode. It won't show the exact value, but you'll see
the changes depending on the starting values if the area in question is
'inside'. If it isn't, try making it 'inside' by setting the max. iteration
count to a low value, or modify the formula so that it has no bailout (so no
'outside' parts.)






Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 09-11-00 (Sunflower [4])
Date: 09 Nov 2000 00:01:01 -0500 (EST)


Classic FOTD -- November 09, 2000 (Rating 4)

Fractal visionaries and enthusiasts:

Today was an exceptionally busy one here at Fractal Central,
leaving almost no time for fun with fractals.  But I did find
another midget.  This midget is surrounded by what appears to be
the petals of a sunflower, so that's the name I gave it.

The expression -10Z^(-1.3)-Z^(-13)+(1/C) was calculated by the
MandelbrotMix4 formula to create the image, which is not at all
exceptional, rating a somewhat below average 4 on my scale of
fractal worthiness.

The parameter file's 9-1/2 minute render time is slow enough to
make a download of the image file from:

          alt.binaries.pictures.fractals

or in a few hours from:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

the more efficient way to go.

The fractal weather started deteriorating today, with lots of
clouds and a temperature of 64F (18C).  Recognizing less-than-
perfect conditions, the fractal cats spent only a limited time
outdoors.

As for philosophy, there is none, but I'll return in 24 hours
with a hopefully higher-rated fractal and more to tell about it.
Until then, take care, and may the better man win.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Sunflower          { ; time=0:09:37.21 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=+2.72767006651009100/+0.39885761742574140\
  /1.266804e+008/1/-105 params=10/-1.3/1/-13/-2/100
  float=y maxiter=2400 inside=0 logmap=144 periodicity=9
  colors=000bQR<9>hbihckidm<3>kit<13>RnnQnnOnm<3>Jol<3\
  >FgaEeZDcXCaUB_R<3>7PH6ME5JB5I97L88M8AP8BQ8CT8EU7FX7\
  HY7I`7<5>Qh6Sj5Tk5<2>Xp5Zq4_t4`v4by4cz4dz4ez6ey8<3>f\
  nEfkFfjH<13>iMaiKcjJd<3>jCj<3>XQmTUnQXoN_o<25>OHDOGC\
  OFA<3>OD5<2>D2t<17>RJxSKxSLy<3>VOy<6>IcWGeSEgN<3>7o7\
  <3>VVV`P`fKf<2>x5w<3>3x_<23>BpPBpPBpO<2>CoNCoNFpO<3>\
  NrOPsORtOTtOVuO<8>ivIkvHmvG<3>svE<2>tnJ
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 10-11-00 (Distracted Fractal [3])
Date: 09 Nov 2000 20:29:36 -0500 (EST)


Classic FOTD -- November 10, 2000 (Rating 3)

Fractal visionaries and enthusiasts:

Today's fractal rates only a lowly 3.  It earned this lowly
rating because I was preoccupied while searching for the FOTD by
the election chaos here in the U.S. and couldn't concentrate on
the business of finding fractals.

In the eyes of the world, this election situation must make the
U.S. look like an illiterate nation that can't even tally up its
own votes.  (Which may be true.)  Since the confusion distracted
me from more productive things, I named the picture "Distracted
Fractal" to explain its paucity.

I'm not going to discuss the fractal, which speaks for itself.
The best way to hear or rather see it speak is to download the
GIF image file from the Usenet binary group:

          <alt.binaries.pictures.fractals>

or from the web site:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today was cloudy with spitting rain that
never amounted to anything.  The temperature of 63F (17C), was
quite mild for mid-autumn.  The fractal cats, after observing
the morning from the cover of the porch, decided that the
outdoors was too wet, and passed the afternoon sleeping.

Now it's time to shut down the fractal shoppe and call it an
evening.  Instead of overloading myself with election hype, I'm
going to settle down and watch a great old "creature feature"
style movie or two.  Until next time, take care, and see you
in 24 hours.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Distracted_Fractal { ; time=0:10:34.06 -- SF5 on a P200
  reset=2000 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=+1.907196013519638/-0.7756187527715576/1.\
  567757e+007/1/-102.499 params=10/-1.3/1/-13/-2/100
  float=y maxiter=1400 inside=0 logmap=200 periodicity=9
  colors=0000Qd0Rb0Rb0Rb0Ta0Ta0Ta0Rb0Qb0Ob2Nb6NbBLdEJd\
  IIdLGdOGdTEfXDf_Bfb9ff9fd8bb8ab8Ya6X_6V_6RY4QY4OX4LV\
  2JV2GT2ER1DR19Q18G0BL08Q16V84_D1dJ0iQ0qR0lV0gX2b_9Ya\
  GVdN<2>GkfBnl8pq0z4Dz8iz9zz9zzBzxBzsBznDziDzdDzYBz_D\
  z_Dz_Ez_EzaGzaGzaGzaI<2>zbJzbJzbLzdLzdNzdNzdNzfOzfOz\
  fQzfQzfQzdNzbLzaJz_IzYEzXD<3>zQ4zO2zN1<3>zG0zB0zE0zG\
  1xIB<3>VOn<3>nDas0az0Q<4>z0Qz1Q<3>zEQzIQzLQxOQwRQwVQ\
  tYQsaQsdQqgQtlOqkQpkQ<2>ikQgkQfiR<2>_iRYiRXiRVgTTgTQ\
  gT<2>LgTJgTIiVIkVIkXGlXGnYGnYGpYEp_Eq_EsaDsaDtaDwbDw\
  bBxdBxdBzd9zf<2>9zg8zg8zi8zi6zk6zk6zk6zl4zl4zn4zn4zl\
  4zn4zn4zp4zp4zq4zq4zs4zs4zs4xt4wt4tw4qw4px4nx4lx4kz<\
  2>4dz4bz4az4_z4Yz4Xz4Tz<3>4Nz4Lz0Iz<4>BJzDJzGJzIJzJJ\
  zNJzOJz<3>XJz_JzaJzbJzJEzdJzzLzxNzxNzxOzxOzxQzxQzxRz\
  xRzxTzxTz0Oz0Qz0Qz
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: htes htes <[e-mail]>
Subject: (fractint) How to run Fractint in the Background?
Date: 09 Nov 2000 20:10:43 -0800 (PST)

Hi, I was wondering if it is possible to run the DOS version 20.0 of
Fractint in a box in windows 95, so that I can do other things while
fractals are generating.

My question pertains specifically to running a batch file to generate a
sequence of images. i.e.

start.bat -------

fractint @parfile1
fractint @parfile2
fractint @parfile3
fractint @parfile4

How can I minimize or restore the Fractint window such that other things in
Windows 95 can be done while Fractint is running?

If I have a 800 frame animation, I don't want my computer tied up for that
enitre time, I should be able to do other things on my computer while it is
running.

Any tips?
thanks










_______________________________________________________
Say Bye to Slow Internet!
http://www.home.com/xinbox/signup.html


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "David Jones" <[e-mail]>
Subject: Re: (fractint) How to run Fractint in the Background?
Date: 09 Nov 2000 18:30:31 -1000

Sure you can (I've done it), but don't expect to get much
else done with W95. And be very careful about your
display drivers - W95 doesn't always play nice with DOS
graphics programs.

On  9 Nov 00 at 20:10, htes htes wrote:

> Hi, I was wondering if it is possible to run the DOS
> version 20.0 of Fractint in a box in windows 95, so that
> I can do other things while fractals are generating.
>
> My question pertains specifically to running a batch
> file to generate a sequence of images. i.e.
>
> start.bat -------
>
> fractint @parfile1
> fractint @parfile2
> fractint @parfile3
> fractint @parfile4
>
> How can I minimize or restore the Fractint window such
> that other things in Windows 95 can be done while
> Fractint is running?
>
> If I have a 800 frame animation, I don't want my
> computer tied up for that enitre time, I should be able
> to do other things on my computer while it is running.
>
> Any tips?

Run it under OS/2. Works just fine here!

Another blast of bits from David
http://home.hawaii.rr.com/aliasjj/   http://www.hawastsoc.org/
For the best Hawaii & Pacific Basin surf forecast:
    http://www.surfreporthawaii.com

Random Thought for this Nanosecond
Unused genius is identical to foolishness. (D.Jones)



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Scott Boyd <[e-mail]>
Subject: Re: (fractint) How to run Fractint in the Background?
Date: 10 Nov 2000 00:21:22 -0600

On Thursday 09 November 2000 22:30, you wrote:

> > How can I minimize or restore the Fractint window such
> > that other things in Windows 95 can be done while
> > Fractint is running?
> >
> > If I have a 800 frame animation, I don't want my
> > computer tied up for that enitre time, I should be able
> > to do other things on my computer while it is running.
> >
> > Any tips?
>
> Run it under OS/2. Works just fine here!
>
Or run Xfractint with a true multi-tasking OS like Linux. Xfractint behaves
well with Linux also!

Scott Boyd
--
[e-mail]
http://home.swbell.net/sdboyd56/
A computer without a Microsoft operating system
is like a dog without bricks tied to it's head.

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "David Jones" <[e-mail]>
Subject: Re: (fractint) How to run Fractint in the Background?
Date: 09 Nov 2000 21:35:51 -1000

On 10 Nov 00 at 0:21, Scott Boyd wrote:

> On Thursday 09 November 2000 22:30, you wrote:
>
> > > How can I minimize or restore the Fractint window such
> > > that other things in Windows 95 can be done while
> > > Fractint is running?
> > >
> > > If I have a 800 frame animation, I don't want my
> > > computer tied up for that enitre time, I should be able
> > > to do other things on my computer while it is running.
> > >
> > > Any tips?
> >
> > Run it under OS/2. Works just fine here!
> >
> Or run Xfractint with a true multi-tasking OS like
> Linux. Xfractint behaves well with Linux also!

My other box is running Linux right now (in fact, I'm
looking at consolidating my two boxes into one
triple-booting thing - W9x, OS/2, Linux) so I can put in
a home file and print server). I've never installed any
X-apps on the system except those that came with it. Any
pointers?


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: [e-mail] (Thomas Beyer)
Subject: Re: (fractint) How to run Fractint in the Background?
Date: 10 Nov 2000 12:48:34 +0100



htes htes schrieb:
>
> Hi, I was wondering if it is possible to run the DOS version 20.0 of
> Fractint in a box in windows 95, so that I can do other things while
> fractals are generating.
>
In Windows there are always problems with fractint's graphic-routines.

Using Disk-Video, however, I never had a problem running fractint in the
background in a DOS-box. Win95 is at least as stable, that it won't be
clogged by a DOS-applicatian (as it might have been with Win 3.x).

Of course you must accept, that you are using CPU-power, so playing
computer-games or downloding  huge files in the foreground is not
recomended. Most other things (even internet-access) are generally
possible.

(I'm running fractint, while sending this message BTW, I hope it won't
become a mess :-)

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) Re: Obscure case where diffusion gives poor estimates.
Date: 10 Nov 2000 14:24:04 EST

>What is the mode assigned to AF7 in your CFG file?

Disk video, 1024x768x256.
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) How to run Fractint in the Background?
Date: 10 Nov 2000 14:32:26 EST

>Hi, I was wondering if it is possible to run the DOS version 20.0 of
>Fractint in a box in windows 95, so that I can do other things while
>fractals are generating.
>
>My question pertains specifically to running a batch file to generate a
>sequence of images. i.e.
>
>start.bat -------
>
>fractint @parfile1
>fractint @parfile2
>fractint @parfile3
>fractint @parfile4
>
>How can I minimize or restore the Fractint window such that other things in
>Windows 95 can be done while Fractint is running?
>
>If I have a 800 frame animation, I don't want my computer tied up for that
>enitre time, I should be able to do other things on my computer while it is
>running.
>
>Any tips?
>thanks

Sure. Run it in disk-video mode, in a DOS box (return from mullscreen when
disk-video is set), and push in the "run in background" button on the
toolbar of the DOS box. As for the batch file, design it like the
makemig.bat output for D&C images:

Fractint batch=yes overwrite=yes @dem.par/deep_1_63
Fractint batch=yes overwrite=yes @dem.par/deep_1_64
...

The par entries should set a disk video mode (a good reason to assign
1024x768x256 disk-video to a key in fractint.cfg -- I use AF7) and a
savename. For better crash recovery, use savetime=60 or so in sstools.ini.
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) How to run Fractint in the Background?
Date: 10 Nov 2000 14:37:03 EST

>Of course you must accept, that you are using CPU-power, so playing
>computer-games or downloding  huge files in the foreground is not
>recomended. Most other things (even internet-access) are generally
>possible.

Downloading works fine actually. So does Winquake, if you set the priority
above normal.

Downloading is not CPU-intensive -- it is network-intensive. Fractint, OTOH,
is CPU-intensive but not network-intensive. Running a fractal while
downloading a batch of mp3z from Napster is a common state for my machine
these days -- the two tasks make the most of available CPU time and
bandwidth, simultaneously. (I also run a bottom-feeder for GIMPS...)
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "David Jones" <[e-mail]>
Subject: Re: (fractint) How to run Fractint in the Background?
Date: 10 Nov 2000 10:34:43 -1000

On 10 Nov 00 at 12:48, Thomas Beyer wrote:

> Using Disk-Video, however, I never had a problem running
> fractint in the background in a DOS-box. Win95 is at
> least as stable, that it won't be clogged by a
> DOS-applicatian (as it might have been with Win 3.x).
>
> Of course you must accept, that you are using CPU-power,
> so playing computer-games or downloding  huge files in
> the foreground is not recomended. Most other things
> (even internet-access) are generally possible.

Well, when I used to try it (running in disk video
mode) on this system, everything else in W95 - mouse
movements, appearance of drop-down menus, etc - became
jerky and slow. Wasn't doing any games or downloads,
although I was most often trying to work on a book. In
fact, couldn't do any kind of Internet activity (we were
using a dialup connection at the time, and W95 just
doesn't seem to do well with real-time communications
running).

On the same box under OS/2, I didn't have any such
problems. I still don't have any such problems.

Also W95 and Fractint would regularly fight over the
display adaptor, freezing the system. I've never
encountered that under OS/2.

Anyway, I'm going to check out XFractint, my Linus box
has a faster processor in it, anyway! 8-)


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: htes htes <[e-mail]>
Subject: Re: (fractint) How to run Fractint in the Background?
Date: 10 Nov 2000 15:35:44 -0800 (PST)

hey thanks.  But I still have problems when I run the batch file

everytime the batch file runs fractint with a new paramenter specified, it
changes to full-screen, and then goes back to a window in disk video mode.

How do I set it up so that, when you type in fractint @blah.par/blah it
stays in a window all the time?  Right now, factint goes to full screen then
immediatly switchs back to a window.  I need it to be running in a window
all the time.  More specifially, I need to be able to run fractint in a
window, exit from fractint, then start up fractint again while still keeping
it in a window the whole time.

Just setting it to disk video mode doesn't prevent it from switching from
full screen to a window everytime fractint is started.

Thanks.





_______________________________________________________
Tired of slow Internet? Get @Home Broadband Internet
http://www.home.com/xinbox/signup.html


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) How to run Fractint in the Background?
Date: 10 Nov 2000 18:59:01 EST

>hey thanks.  But I still have problems when I run the batch file
>
>everytime the batch file runs fractint with a new paramenter specified, it
>changes to full-screen, and then goes back to a window in disk video mode.

I've noticed this too. Don't know why it does this -- IMO it's a bug,
Fractint must be changing text modes or something unnecessarily. There is a
workaround -- if the dos box doesn't have the focus, it doesn't happen!


_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: htes htes <[e-mail]>
Subject: Re: (fractint) How to run Fractint in the Background?
Date: 10 Nov 2000 17:26:44 -0800 (PST)

>  >hey thanks.  But I still have problems when I run the batch file
>  >
>  >everytime the batch file runs fractint with a new paramenter specified,
it
>  >changes to full-screen, and then goes back to a window in disk video
mode.
>
>  I've noticed this too. Don't know why it does this -- IMO it's a bug,
>  Fractint must be changing text modes or something unnecessarily. There is
a
>  workaround -- if the dos box doesn't have the focus, it doesn't happen!
>
>

Awesome man, thanks.  Now, its off to work on my 800-frame zoom to (-2,0) at
magnification level 1.502*10^256!!  :)





_______________________________________________________
Tired of slow Internet? Get @Home Broadband Internet
http://www.home.com/xinbox/signup.html


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 11-11-00 (Fractal Stickers [4])
Date: 10 Nov 2000 23:58:46 -0500 (EST)


Classic FOTD -- November 11, 2000 (Rating 4)

Fractal visionaries and enthusiasts:

What does the whimsical expression 1.3Z^(-10.6)+6.7Z^(-1.7)+(1/C)
do when iterated?  Why it creates a fractal, a fractal with
midgets.  And today's picture illustrates one of these midgets.

I named the picture "Fractal Stickers" because the sharp
filaments surrounding the midget remind me of the burrs that
sometimes get stuck on the fractal cats when they wander too far
afield.

After careful consideration, I rated the image a 4, which is a
reversal of the steady decline of the past several days, but
still below average.  The parameter file takes about 3 minutes to
set up and 4-3/4 minutes to run.  The GIF image file takes about
2 minutes to access and 1/2 minute to download.  The image file
may be found at:

          <alt.binaries.pictures.fractals>

and at:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today was partly cloudy and blustery, with a
temperature of 63F (17C).  The temperature was mild enough for
the fractal cats, but the wind was a bit too high for them to be
comfortable outdoors, the thrashing branches keeping them
constantly on alert.

I'm exhausted after another day of high anxiety, so I'm going to
settle down to watch another junky movie.  I'll return in 24
hours or so, with another fractal.  Until then, take care.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Fractal_Stickers   { ; time=0:04:44.46 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=+0.2247777530333031/+0.4283983728794734/3\
  .302373e+009/1/139.999 params=1.3/-10.6/6.7/-1.7/0/0
  float=y maxiter=1200 inside=0 logmap=80 periodicity=9
  colors=00022V22V<3>22P22O22N22L22K22J<2>226222220<2>\
  22723C35F05H19F3CD6HA9H9CK6FL5HP2<2>PY0PZ0R`0Xb0`e0d\
  h0ik0ml0ro0zr0zt0zv0<3>zw0zw0zw1zw3zs5fl7db9bXA`bDYb\
  FViHSiJPwL<2>HwRFwUCwVCvVAwXAwXAyYAyYAzZAzZAz`<3>9zb\
  9zb9zd<3>9zeCzfDzhGyhHviKsiLpkOmkPklRilUfmVdoYaoZZpa\
  XpbUreRrfOshNsfOrePrdRrdSrbUraVr`Xr`XrZYrYZrY`rXarVb\
  rUdrUdrSerRfrPhr<2>NlrJmtLlsNlrOlpRloSlmUllXlkYliZlh\
  alf<3>hkaik`lkZmkYokXrkVskUviVtkUtkStkRtlRtlPtlOtmNt\
  mNsmLsmKsoJsoJsoHspGspFspFrpDrrCrrArrA<2>rs6yz0tv3rt\
  6mt9ktCftGdtJ`tL<3>OtYKt`Htb<2>6tl3to1trCtsLts<3>yts\
  wrtvivtbwt`y<2>ptzozzozzfziZzOSz2SzCSzKSzUSzaSzkSzsS\
  zzSzzVzzYzoZzdazUbzJez7fz0lz9pzLtzX<4>szfszhszkszlsz\
  oszpszssztfzk<2>7zN2zX0ze0zo0zy<2>0zz0zz2zz<2>Azz<4>\
  azz0z0
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Morgan L. Owens" <[e-mail]>
Subject: Re: (fractint) How to run Fractint in the Background?
Date: 11 Nov 2000 17:58:26 +1300

At 18:59 10/11/2000 -0500, Multiple Bogeys replied to htes htes by saying:
>>hey thanks.  But I still have problems when I run the batch file
>>
>>everytime the batch file runs fractint with a new paramenter specified, it
>>changes to full-screen, and then goes back to a window in disk video mode.
>
>I've noticed this too. Don't know why it does this -- IMO it's a bug,
>Fractint must be changing text modes or something unnecessarily. There is
>a workaround -- if the dos box doesn't have the focus, it doesn't happen!

What you want to fix are the DOS box settings that Windows uses when
running Fractint. Right-click Fractint.exe's icon and choose properties.
The "Screen" tag describes how Windows displays the DOS box (since these
days DOS runs in Windows instead of the other way around). You currently
have it being displayed in a window instead of full-screen. Change that and
it won't do that jumping back and forth to a window any more.

That's the workaround, the permanent solution (work in progress) is to
rewrite Fractint's video code to avoid all the low-level speedups that
assume that Fractint is the only program using the video card. Once upon a
time (like six years ago), this would have been the case, but not now
(since, when run in a DOS box, Fractint doesn't really have access to the
video card, only a Windows-supplied emulation of one).

If you're running in batch mode, and you want to keep Windows running in
the meantime, you could instead try minimising the DOS box window. If
you're not doing anything else at the time, you might want to consider
shutting down Windows, give DOS the processor, and then Fractint's
assumptions about where it's running would be correct.

Further detail available from the Fractint home page at
http://spanky.triumf.ca/www/fractint/fracwin95.html

Morgan L. Owens
"You want the image in a window? Why waste all that real estate on chrome?"



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "=?windows-1250?B?UHVza+FzIElzdHbhbiBqci4=?=" <[e-mail]>
Subject: Re: (fractint) Re: Obscure case where diffusion gives poor estimates.
Date: 11 Nov 2000 18:25:15 +0100

>>What is the mode assigned to AF7 in your CFG file?
>
>Disk video, 1024x768x256.

I have an idea what's going on. I saw that in video modes where drawing the
large boxes that diffusion uses is _lot_ slower than drawing single pixels -
probably the box drawing can't be optimized - that diffusion gives extremely
long times in the estimation, like 10 minutes at first then it finishes in 4
seconds. First, it could be that drawing the boxes in that disk-video mode
is easier than drawing single pixels or at least the overhead of the box
drawing is less than expected (maybe it needs less math with pointers or
less buffer switches? I don't know how that works.) Another possibility is
that the areas of the image where diffusion hits first are faster than
others encountered later.

Try setting the fill color to 0, in that case diffusion won't draw filled
boxes, only single pixels. That fixed the cases where starting the image was
very slow because of the large boxes and the estimations were _very_
'pessimistic', it may change it now too.




Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 12-11-00 (Wings of Iteration [5])
Date: 11 Nov 2000 19:38:06 -0500 (EST)


Classic FOTD -- November 12, 2000 (Rating 5)

Fractal visionaries and enthusiasts:

Rating a 5, today's fractal is one step above yesterday's.  Now
if I can continue this gradual improvement for 5 more days,
we'll have an honest 10 rated image for the 17th.

I named the picture "Wings of Iteration".  It has a certain
airborne feeling about it that inspired the name.  With a
running time of 8-1/2 minutes, the parameter file is a bit slow,
making a download of the GIF image the wiser choice.

As always, the GIF image file may be found at:

          alt.binaries.pictures.fractals

and at:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today was partly sunny, though quite breezy.
The 60F (15.5C) temperature was mild enough -- too bad the high
wind kept the fractal cats so skittish that they remained
indoors.

As is obvious by the shortness of the recent discussions, I've
not been inspired to write philosophy for quite some time.  The
reason is that I'm disgusted by the political chaos here in the
U.S.  (Politics is the one thing that can really make me lose my
cool.)  But come tomorrow, I'll have at least another fractal,
even if the words are few.  Until then, take care, and sometimes
the greatest wisdom comes in the fewest words.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Wings_of_Iteration { ; time=0:08:26.36 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=-0.56120497942872340/+1.28019792586280400\
  /12622.28/1/-90 params=10/-1.3/1/-13/-2/100 float=y
  maxiter=2000 inside=0 logmap=110 periodicity=10
  colors=000MTALXAJ_A9aO0a_0Gk00cnu_kpT<2>ffAdc9c_9aX9\
  _V9ZR7XO7VM7VJ7TG5RE5QA5S75M53L23J03J03H0A<2>H0Qc0cw\
  0pz0zz2zz3yz7wz9uzAszErwGpsHnrLmnMk<2>fTfdVdcZfMJQac\
  hafhahi_ki_mk_pkZskZumXymXznXznVzpVzpVzpZzsazuczwfuy\
  zyzkmznizpfznazmXzmTzkOziJziGzhAyf5wf2wd0uc0sc0sZ0kV\
  9dRJXMRQJaJGkAAs37z03z00z0<2>0z00z30z90zG0yL0wQ0sV0p\
  _0mf0ik0fp0cu0az2Xy9TyEQyLLyQHwXEwa9wh5wm2w<2>rRVs_M\
  uhEwdHwcLyaOyZRyXVzVZzRa<2>zMksXakdRcmHVi9ncVzLpzMws\
  OzmQzfRzaRzdTzhVziXzmZznZzr_zsazwczyczzdzzfzzhzzhrz_\
  iuRanJThALh5Oh5Ri3Qi3Oi3Mk3Lk3Jk3Jm3Hm3Gm3En3Cn3Cn2A\
  p29p27p25r23r23r22s20s20s20z70y50u30s20p02<5>a0XZ0aX\
  0fT0k<2>L0z<2>E0zC0zC3uAGkARa9cR9nH7z7Az0Cz3<3>XzVaz\
  adzf<2>szzyzz<30>zzz
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: htes htes <[e-mail]>
Subject: Re: (fractint) How to run Fractint in the Background?
Date: 11 Nov 2000 18:39:45 -0800 (PST)

properties.
>  The "Screen" tag describes how Windows displays the DOS box (since these
>  days DOS runs in Windows instead of the other way around). You currently
>  have it being displayed in a window instead of full-screen. Change

Full screen? I don't want it to display full screen, I want it in a window.


Anyhow, I've allready found a solution. (before I do any of this I set a
disk-video mode in sstools.ini)  What I do is open a dos box in a window.  I
cd to fractint, then type the word start (this is my batch file for
animations), but I don't hit ENTER just yet.  I then find another window, it
doesn't matter which other window it is.  I resize the window to a size
small than the DOS box and put it below the DOS box.  Then I go back to the
DOS box, which has the word 'start' sitting at the prompt, and I smack the
ENTER key.  Immediatly, I mean less than half a second later, I click on the
top bar of the misc. smaller window.  This takes the 'focus' away from the
DOS box, and fractint can then be started and shut down from within the
batch file without jumping to full-screen and back again every time fractint
is restarted.

One slight problem: I have to remember NEVER to click on the DOS box, which
will give it the focus.  If this happens, the computer will freeze in a loop
of jumping from full-scren to window to full-screen to window etc...

My only other question is:  Why haven't they updated the windows version to
20.0??  version 18.21 for Windows was greatly dissapointing, as it was
severely stripped down in its features. (no batch mode?  No pallete cycling?
no pallete editor???)

I would LOVE to see a full-featured windows port of dos version 20.0.  This
would eliminate screwing around with DOS settings to force it to behave like
you want it to.  Is there ever going to be a windows version?






_______________________________________________________
Tired of slow Internet? Get @Home Broadband Internet
http://www.home.com/xinbox/signup.html


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 13-11-00 (The Cosmic Mystery [6])
Date: 13 Nov 2000 00:27:05 -0500 (EST)


Classic FOTD -- November 13, 2000 (Rating 6)

Fractal visionaries and enthusiasts:

Today we continue our day-by-day climb up the ratings ladder
with a fractal that rates a 6.  The iterated formula subtracts
Z^(-6.666) from Z^(-6.66) and multiplies the minute difference
by a factor of 19999 before adding 1/C.

The result of this operation is a rough open circle with a
shallow bay at its east edge.  The circle is filled with a ring
of fractal islands, the most interesting island lying in the
east bay.  Today's midget lies at the tip of the negative tail
of a larger midget that lies near the center of this east bay
island.

I named the picture, which is filled with comma-shaped elements,
"The Cosmic Mystery".  The reason I gave it such a name eludes
me.  I suppose there's something mysterious about it, a
possibility heightened by the rather somber dark blue color
palette.

The parameter file renders in a little more than 5 minutes.  A
quicker way to see the mystery is to download the GIF image from:

          <alt.binaries.pictures.fractals>

or from:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today featured sun, clouds, wind, and a
temperature of 57F (14C).  This combination was barely
acceptable to the fractal cats, who spent only 15 minutes out of
doors.

The day is finished; tomorrow is ready to begin.  It's time to
shut down the fractal shoppe and call it a night.  Until next
time, take care, and see you in 24 hours.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

The_Cosmic_Mystery { ; time=0:05:18.29 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=+0.96820939344254350/+0.00080761418055334\
  /7.534044e+010/1/80 params=1/-6.66/-1/-6.666/-20000/0
  float=y maxiter=1200 inside=0 logmap=106 periodicity=9
  colors=000M0FL0FL0GJ0IJ0JI0LI1M<3>C7SA9T9AV7CX6DY9G`\
  AJc<3>MVoOYrQ`uTcxXfz_izzzz`lz`jz`ix`fs`dp`cl``g__d_\
  Y`_VY_TT_SP_PM_OI_MFYQIXVLVYOTaQSdTSiXQm_PpaOudMxgLz\
  jTzmgzVvyDzv0zs0zp0vm0oj1gg4`d6Tc9MaAIaDIdCGcFFcGDcI\
  DaJCaMAaOA`P9`Q7`T6_V6_X4_Y3Y`3Ya1Yc0Xd0Xg0Xi0Vj0Vl0\
  Vo0Tp0Tr0Or0Ts0Yu0av0gx0ly<2>0zz<2>1zz<2>9zyCzvFzsGz\
  pJzm<2>QzdSzaVz_YzX_zT<3>izIlzFmzCpz9rz7oyCmxFjuJisM\
  gpPdoTclXaj__gcYffVcjTamS_pPYuOVxMTzJQzIPzFMz<3>LSzM\
  TzMVzOXzPXzQYzS_zT`zTazVczXdzYfz_fz`gz`iz<2>dmzfozfo\
  z_pzSrzMsyFuv0vv9xsIypQzm`zl<2>zzdxzavz`uz_szXrzVpzT\
  ozSmzPlzOizMgzLfzIdzGczFazD`zA_z9Yz7Yz4Xz6Vz7Tz7Sz9Q\
  z9PzAOzAOzCMzDLzDJzFIzFGzGFzGDzIDzJCzJAzL9zL7zM6zM4z\
  O4zO6zP<2>7zQ7zQ9zS<3>AzTAzTCzVCzVCzVDzXDzXCz_DzXDzT\
  DzQFzPFzMFzJGzIGzFGzCIzAIz7Iz4Jz3Jz0Jz0Mz0Jz0Izg
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 14-11-00 (Ignacio [7])
Date: 13 Nov 2000 19:13:02 -0500 (EST)


Classic FOTD -- November 14, 2000 (Rating 7)

Fractal visionaries and enthusiasts:

With today's fractal we continue the one-step-a-day climb to the
fractal heights.  Perhaps with a bit of exaggeration, I rated
today's image a 7.

The scene exists in a remote (but not too remote) part of the
infinite logarithmic spiral that is the fractal created by the
simple formula Z^1.43+C.  All fractals in this range are filled
with discontinuities -- branch cuts if that's what you would
call them.  These breaks frequently spoil an image by cutting
right through the most interesting part of it, but sometimes the
breaks become so pervasive that they form their own patterns.
Today's image consists entirely of such fractal bits and pieces.

I named the picture "Ignacio".  Once again I cannot justify my
choice -- I simply like the sound of the word.  As is the case
in most of my fractals, a minibrot lies at the center of the
screen.  This midget is typical of midgets when the exponent of
Z in the generating formula is in the range of 1.43.  The midget
is immediately identifiable as a minibrot, but its shape is
distorted almost beyond recognition.

The scene is filled with smaller midgets, one of which sits on
the longest filament.  If this smaller midget is interesting, I
might pull it up and declare it FOTD in a coming post.

The color palette of today's image features a cloud of fiery
foreground fragments floating before a hazy blue background.
The draw time of the parameter file is 6-3/4 minutes on an aging
Pentium 200mhz machine.  As is always the case, the GIF image
file can be downloaded in one minute or so from the Usenet
binary newsgroup:

          <alt.binaries.pictures.fractals>

It will soon also be available on Paul Lee's web site at the URL:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The day's weather featured lots of clouds, a raw wind, and a
temperature of 54F (12C) -- unpleasant enough to keep the
fractal cats snugly indoors, wishing they could be comfortable
out in the yard.

And I wish I could find that philosophical muse, which seems to
have deserted me.  I'll try to philosophize tomorrow.  If I
fail, I'll still have a fractal.  Check then to see what
happens.  Until next time, take care, and see you soon.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Ignacio            { ; time=0:06:45.50 -- SF5 on a P200
  reset=2001 type=formula formulafile=branchct.frm
  formulaname=MandelbrotBC passes=1 center-mag=+0.3055\
  2729081659520/+1.59327449871295100/1983.157/1/175
  params=1.43/0/-0.47/0 float=y maxiter=30000 inside=0
  logmap=95 symmetry=none periodicity=10
  colors=000zUHzUGzRGzPG<3>wGGwEGvEG<3>qDGpDGpCFoCFmCF\
  lCFkAFjAFhAF<4>d8Fc8Fa8F<3>Z7EY7EW6E<2>U5ET5ER5EQ5EP\
  3EO3EN3EL3EL2C<3>H1FG1GE1HE0I<3>90K80K70L00D20G50I70\
  M91PC2RE3VH6XJ7Z<2>QChTDkVGmYHp_IscIwaJu<4>aKuaKt`Kt\
  <2>`Lt`Lt`Ns<8>_PrZPrZPrZQp<4>ZRpYRoYRoYTo<3>YUnYUnW\
  Un<3>WVmWVmWWmVWmVWnVWoVYpVYrVYsVYt<3>QTyPRzOQz<4>IK\
  zHJzGIzEHzDGz9EzADzCEzDEzEGz<3>JHzKIzLIz<3>RKzTKzULz\
  VLzWNy<3>`OxaPwcPwdQueQufQugRthTtjUt<3>mZtm_to`t<3>r\
  essfsugs<3>xlsxmsyos<2>zrsworrkrogpjdpf`oaYoZUnUQnQN\
  mLJmIGlDCl21b98lECuGEwHHxIIyJKzKLzLOzNPzORzPUzQVzRYz\
  TZzU`zVazWdzVfzWezWdzWczYazY`zY_zmLzmLzoKz<5>sJzsJzu\
  Jz<4>xIzxIzyIz<4>zHz
  }

frm:MandelbrotBC = { ; Z = Z^E + C
  e=p1
  p=real(p2)+PI
  q=2*PI*trunc(p/(2*PI))
  r=real(p2)-q
  Z=C=Pixel:
    Z=log(Z)
    IF(imag(Z)>r)
      Z=Z+flip(2*PI)
    ENDIF
    Z=exp(e*(Z+flip(q)))+C
  |Z|<100
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Paul DeCelle <[e-mail]>
Subject: (fractint) Re:
Date: 14 Nov 2000 00:54:22 -0500

Hi,  b=E4rbel-

I'm sorry I haven't replied sooner - I changed over my ISP a month or so =
ago and haven't yet
canceled my old service.  I just got around to checking my 'old' emails t=
onight...

Anyway, I use Ultra Fractal -  http://www.ultrafractal.com  - to create m=
y fractal images.  It's
shareware that's free for the first thirty days.  After that, it can be p=
urchased for US $35.

I've found that the best way to learn to use the Ultra Fractal program is=
 to first proceed through
an excellent series of beginning tutorials that can be found at
http://www.parkenet.org/jp/ufresources.html

Almost all of the formulas folks have written for UF can be downloaded fr=
om
http://formulas.ultrafractal.com/

You can also sign up to the Ultra Fractal Mail list at
http://www.fractalus.com/ultrafractal/list.htm - Every day, people are po=
sting parameter files to
this list, which can be very instructive to both new and experienced user=
s.

BTW, my new email address is [e-mail].  Any replies should =
be directed there, as I'll
soon be discontinuing this Prodigy account.

I hope this helps!

Regards, Paul





Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: cindy mitchell <[e-mail]>
Subject: (fractint) Video
Date: 14 Nov 2000 12:18:54 -0800

Hello,
I am forwarding this message to the list. Hopefully
someone can help.
  Thank you,
   Cindy

>Great site fractallady!
>I am desperately trying to find a video on fractals to give to a friend for
>xmas.
>She tells me she saw the program on PBS a few months ago,
>Did you see it?
>I searched the PBS web site...no luck.
>Any other really good fractal videos out there?
>Not just music and fractal imagery, but with  commentary as well?
>Thanks,
>[e-mail]
>
Fractals Galore - http://www.geocities.com/Paris/Rue/1195/
Fractals Galore II - http://www.geocities.com/fractlady_2/index.html
More Fractals - http://www.geocities.com/Paris/Rue/3741


Click here for Free Video!!
http://www.gohip.com/freevideo/


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) Re:
Date: 14 Nov 2000 15:57:34 EST

>Anyway, I use Ultra Fractal -  http://www.ultrafractal.com  - to create my
>fractal images.  It's
>shareware that's free for the first thirty days.  After that, it can be
>purchased for US $35.

Ugh, yuck, bleah, money, credit cards, greed, exclusion, elitism...thank
goodness for astalavista.box.sk. :)

>I've found that the best way to learn to use the Ultra Fractal program is
>to first proceed through
>an excellent series of beginning tutorials that can be found at
>http://www.parkenet.org/jp/ufresources.html

If you can put up with the frequent crashes, you might succeed in
accomplishing something (by sheer luck and serendipity) after about 72 hours
of knob twiddling. (Note that when UltraFractal crashes, it doesn't simply
pop up an "illegal operation" box and die, leaving you at your desktop, with
your other work intact and one double-click away from being back in the
fractal business. Oh, no. UltraFractal doesn't do anything in less than an
"ultra" way -- including crash. When UltraFractal has an ultracrash, the
whole machine locks up hard. The power switch is the only recourse.
Doubleclicking that cute mandelbrot icon while you are typing up your resume
in Word 97 is playing Russian roulette with your career prospects...)

>Almost all of the formulas folks have written for UF can be downloaded from
>http://formulas.ultrafractal.com/

...and then used in ChaosPro 2.1 by the computer-savvy and those with
resumes and money they'd like to actually keep, as well as those with
resumes and no money or at least no credit card who have yet to discover the
wonders of astalavista.box.sk...

>You can also sign up to the Ultra Fractal Mail list at
>http://www.fractalus.com/ultrafractal/list.htm - Every day, people are
>posting parameter files to
>this list, which can be very instructive to both new and experienced users.

I think seeing your first ultracrash is even more instructive, especially
when you've stumbled onto the ChaosPro 2.1 Web page...
show me an experienced UltraFractal user, and I'll show you a current
Fractint/ChaosPro user.

(In all fairness, I can understand how difficult it can be to debug a crash
that locks the machine hard -- no crash traceback, no core dump, no useful
debugging information, even if you put debugging commands in to log the
values of suspect pointers to a file, you'd end up with a zero length file
after the reboot, and no information -- I've tried to debug these kinds of
crashes before. Nonetheless, an app that dies that horribly and that
frequently is simply not release-worthy -- if worse comes to worst they
should just revert to an older version and reimplement the latest features
from scratch, taking great care with their use of pointer arithmetic...some
use of C++ and its standard library templates should cut down on pointer
problems and crashes. And then there's always Java...)
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Kenneth Childress <[e-mail]>
Subject: Re: (fractint) Re:
Date: 14 Nov 2000 13:20:51 -0800 (PST)


> >Anyway, I use Ultra Fractal -  http://www.ultrafractal.com  - to create my
> >fractal images.  It's
> >shareware that's free for the first thirty days.  After that, it can be
> >purchased for US $35.
>
> Ugh, yuck, bleah, money, credit cards, greed, exclusion, elitism...thank

Funny, most things cost money.  It's certainly nice when programmers
create freeware products, but you're rather arrogant to expect it.

Regardless, is that justification to promote theft?

[Nonsensical UF trashing deleted]

> >You can also sign up to the Ultra Fractal Mail list at
> >http://www.fractalus.com/ultrafractal/list.htm - Every day, people are
> >posting parameter files to
> >this list, which can be very instructive to both new and experienced users.
>
> I think seeing your first ultracrash is even more instructive, especially
> when you've stumbled onto the ChaosPro 2.1 Web page...
> show me an experienced UltraFractal user, and I'll show you a current
> Fractint/ChaosPro user.

I can show you dozens upon dozens of experienced UF users.  Most of which
are former Fractint users.

FYI, I've used UF extensively for more than two years.  It very, very
rarely crashes.  Certainly not as frequent as you describe.  I'm sure
most users can report the same.



Ken...






Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Gedeon <[e-mail]>
Subject: Re: (fractint) Re:
Date: 14 Nov 2000 16:31:44 -0500

> FYI, I've used UF extensively for more than two years.  It very, very
> rarely crashes.  Certainly not as frequent as you describe.  I'm sure
> most users can report the same.
>
>
> Ken...
>
I too have used UF extensively for two years. To the best of my
recollection, it has NEVER crashed.

Gedeon

FRACTALS: http://members.nbci.com/gedeonp/fractals.html
Last updated: October 4, 2000
Member Infinite Fractal Loop
PHOTOGRAPHY: http://members.nbci.com/gedeonp/photos.html
Last updated: July 10, 2000


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 15-11-00 (Infinite Regress [4])
Date: 14 Nov 2000 22:09:46 -0500 (EST)


Classic FOTD -- November 15, 2000 (Rating 4)

Fractal visionaries and enthusiasts:

I had hoped to have a fractal that rated an 8 for today, but
alas, such lofty images are difficult to find, and I lacked the
time to do a proper search.  Forced by circumstances beyond my
control to substitute an fractal of lesser quality, I settled on
today's image.

Today's fractal features a midget.  This is nothing unusual,
since nearly all my fractals feature midgets.  This particular
midget is found in the fractal that results when the expression
-Z^(-13)-10Z^(-1.3)+1/C is iterated.  It's a fairly routine
midget, lying in an area that at first appears non-critical.

The fractal detail surrounding the midget is lively enough, but
it just doesn't make a pleasing impression.  The colors are
brilliant enough, but seem haphazard, and lack an organized
theme.  As a result of these deficiencies, I have rated the
picture a lowly 4.  I named the picture "Infinite Regress",
though this name would seem more appropriate for one of those
endless spirals.

Taking 11 minutes to render, the parameter file tries one's
patience.  But immediate relief in the form of the already-
rendered GIF image file is waiting on Usenet at the binary group:

          alt.binaries.pictures.fractals

and soon will be waiting on the web at:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today here at Fractal Central was rainy in
the morning, followed by clearing in the afternoon, with a
temperature of 55F (13C) that was fair enough.  But the wet
grass kept the dynamic duo of cats confined to the porch.  It
appears that fractal cats don't like to get their paws wet.

No philosophical inspiration has yet appeared.  I'll see what
happens tomorrow.  Until then, take care, and cheer up with a
fractal.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Infinite_Regress   { ; time=0:11:05.96 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=+1.90721041666091600/-0.77564195590960320\
  /3.996636e+007/1/-97.5 params=10/-1.3/1/-13/-2/100
  float=y maxiter=2000 inside=0 logmap=212 periodicity=9
  colors=000U2fU2bN2YG2SG2OD2JD2FA29A25720720020022035\
  05705A05D25G35J55L73O93RA3UD3XF3ZG3aJ3dK3fL3iG0rN3lS\
  9fYFabJYhOSwUNsYJzbDzh7zm1zl3zi6zf7zbAz`CzYFzUGzRJyO\
  LwKNvHPtFRsAUr7Vp5Yt0Zo2Zi6VeCR`GNVLJOU0RPFULdXJzVKy\
  ULtSLrRNmPNkOOfNOdLP`LPYKRUJRRHSNGSKFUGDUDCV97S5CV6F\
  Z7Hb7Kf9Nk9PoASsCVwCYzDZzC`zD`zD`yF<3>`lH`iH`eJ`bJ``\
  J`XK`UK`PL`NL`KN<3>`6P`3Pa0R`1P`3OZ6NZ9LZCKYDJ<2>XLF\
  XODVRCVSAUV9UY7U`6Sb5Se3Uh0Sf2<3>NdHLdLLdOKbSJbXHa`G\
  abGaf<3>ffrmhtpiwskzrkzpkzpkzolzmlzllzllzklzimzhmzhm\
  zfmzemzdozdozbozaoz`oz`pz<2>XpzZtz<2>UhzSdzP`zOXz<3>\
  HGzGCzF7zD5zC7yA9v9As7Cr6Fo5Gl3Hk3Jh2Le1Nd0Oa0PZ0SY0\
  UV0VS0XR2YU9ZXG`ZGa`GbbGdeGefGfiGhlGimGkfGla9mX7oX<3\
  >6tX6vX6wX5yX5zX5zX5zX<4>DzPFzOHzNJzLKzKLzJNzHOzGRzF\
  <3>Xz9Yz7`z6<3>ez1fz0ez3ez71zp0zl
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Paul N. Lee" <[e-mail]>
Subject: Re: (fractint) Video
Date: 14 Nov 2000 21:58:23 -0600

cindy mitchell wrote:
>
> [e-mail] wrote:
> >
> > I am desperately trying to find a video on fractals to
> > give to a friend for xmas.  She tells me she saw the
> > program on PBS a few months ago,  Did you see it?  I
> > searched the PBS web site...no luck.  Any other really
> > good fractal videos out there?  Not just music and
> > fractal imagery, but with commentary as well?
> > Thanks, [e-mail]
> >

As listed in my info at:
    http://home.att.net/~Paul.N.Lee/Fractal_Links.txt

Movies:
    "Colours of Infinity",  a 1-hour video
         (usually airs on local PBS stations)
    The following quote was taken from this website:
          http://www.kcts.org/whatson/magazine/12_98/colours.htm
      "Dr. Arthur C. Clarke, screenwriter of 2001: A Space
          Odyssey and inventor of the space satellite, chronicles the
          1980 disocvery by Dr. Benoit Mandelbrot of a geometrical
          shape which can be used to better understand the physical
          world. Clarke explores this doscovery's impact on the world
          of mathematics - which has included the development of a
          new mathematical discipline: fractal geometry - with the
          help of Dr. Mandelbrot, Prof. Stephen Hawking, Dr. Michael
          Barnsley and Prof. Ian Stewart. Set to a musical score by
          David Gilmour of the rock group Pink Floyd, vibrant computer
          graphics help the audience visualize the M-set and illustrate
          its infinite complexity. Clarke predicts that the next
          generation of devices, which will be built on fractal
          principles, will revolutionize communications, health care,
          the military and computer technology."
    For VHS copies of Colours of Infinity call "Films for the
    Humanities and Sciences" at 1-800-257-5126 between 8:30 am to
    5:00 pm ET.  Information may be found at:
          http://www.films.com/
          http://www.films.com/Dynamic/Item/Item4976A.asp

    "The Alphabet of Shapes: Benoεt Mandelbrot and Fractal Geometry"
    Benoεt Mandelbrot explains his ideas and theories by using
    ordinary objects and occurrences as examples. (35 min.)
          http://www.films.com/Dynamic/Item/Item5434A.asp

    "Fractals, Chaos Theory, and Their Application"
    This is an examination of fractals, their relationship to the
    development of  Chaos Theory, and their practical application
    in the telecommunications industry. (24 min.)
          http://www.films.com/Dynamic/Item/Item7033A.asp

    "Fractals: An Animated Discussion"
    A dazzling computer animation combined with the genius of
    Benoεt Mandelbrot and Edward Lorenz present a captivating
    discussion of fractals and the fundamental concepts of fractal
    geometry. (63 min.)
          http://www.films.com/Dynamic/Item/Item7276A.asp

    "Mathematics and Nature"
    How attempts to describe the order of nature mathematically have
    led to a new geometry: fractal geometry. (23 min.)
          http://www.films.com/Dynamic/Item/Item5532A.asp

    "Is God a Number? Maths that Mimic the Mind"
    This fascinating program examines the computational paradigms
    being used to model human consciousness and to quantify reality,
    from Euclidean geometry to fractal transform algorithms.
    Outstanding computer graphics enhance this exploration of inner
    and outer space with Oxford mathematician Sir Roger Penrose,
    compression technology expert Michael Barnsley, and others.
    (53 min.)

    "The Fractal Experience"
    Found at http://www.amazon.com/
    ~ VHS ~ Usually ships in 24 hours.  Price: $13.99

    "Fractal Lumination"
    Found at http://www.amazon.com/
    ~ VHS ~ Usually ships in 24 hours.  Price: $16.99

    http://home.bc.rogers.wave.ca/kvdoel/mandelmovie.html
    http://fractal.mta.ca/fractals/kvdoel/mandelmovie.html
    http://www.artmatrix.com/mj.html
    http://www.cnam.fr/fractals/anim.html
    http://www.activetools.com/examples/movie/movie.html


Sincerely,
P.N.L.
http://www.fractalus.com/cgi-bin/theway?ring=fractals&id=43&go

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Bob Margolis <[e-mail]>
Subject: Re: (fractint) Re:
Date: 14 Nov 2000 22:21:22 -0600

Kenneth Childress wrote:

> FYI, I've used UF extensively for more than two years.  It very, very
> rarely crashes.  Certainly not as frequent as you describe.  I'm sure
> most users can report the same.
>

I have never experienced a crash using UF, and I've also been using it
for more than two years.

Bob

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: [e-mail]
Subject: Re: (fractint) Video
Date: 15 Nov 2000 01:04:52 EST

Thanks for the list of vids, Paul!

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) Re:
Date: 15 Nov 2000 21:23:00 EST

>Funny, most things cost money.  It's certainly nice when programmers
>create freeware products, but you're rather arrogant to expect it.

I am also a firm believer that things should be distributed at cost,
creating a fair trade. When something is distributed over the Internet, that
cost is unmeasurably small (probably measured in thousandths of a cent),
given that a few bucks of electricity and about twenty bucks a month for
network access is all it takes to keep a server up for a month, during which
tens of thousdands of downloads can be made. Even distributed on CD, the
cost is maybe two bucks per copy, which makes it all the more ridiculous
when you see music disks, disks with Windows 95, etc., for twenty and forty
and even sixty bucks.

>I can show you dozens upon dozens of experienced UF users.  Most of which
>are former Fractint users.
>
>FYI, I've used UF extensively for more than two years.  It very, very
>rarely crashes.  Certainly not as frequent as you describe.  I'm sure
>most users can report the same.

Obviously, you're using a different version. ISTR the 1.something versions
being decently stable. 2.04, however, displays a nasty habit of locking up
the operating system usually within the first five minutes of trying to use
it.
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Harry Bissell <[e-mail]>
Subject: Re: (fractint) Re:
Date: 15 Nov 2000 21:38:44 -0500

<delurk>

It depends on how much IP there is in the program.  If I'm the programmer and
I have 1000 hrs in a product... and I can only sell a small amount of copies...
then
do the math.

I agree that if the work is someone else's... then the price should be fair.

I'm happy to pay a reasonable price for something I actually use.  Fair pricing
reduces piracy by a large amount. Economic Rape encourages it !!!

H^) harry

Multiple Bogeys wrote:

> >Funny, most things cost money.  It's certainly nice when programmers
> >create freeware products, but you're rather arrogant to expect it.
>
> I am also a firm believer that things should be distributed at cost,
> creating a fair trade. When something is distributed over the Internet, that
> cost is unmeasurably small (probably measured in thousandths of a cent),
> given that a few bucks of electricity and about twenty bucks a month for
> network access is all it takes to keep a server up for a month, during which
> tens of thousdands of downloads can be made. Even distributed on CD, the
> cost is maybe two bucks per copy, which makes it all the more ridiculous
> when you see music disks, disks with Windows 95, etc., for twenty and forty
> and even sixty bucks.
>
> >I can show you dozens upon dozens of experienced UF users.  Most of which
> >are former Fractint users.
> >
> >FYI, I've used UF extensively for more than two years.  It very, very
> >rarely crashes.  Certainly not as frequent as you describe.  I'm sure
> >most users can report the same.
>
> Obviously, you're using a different version. ISTR the 1.something versions
> being decently stable. 2.04, however, displays a nasty habit of locking up
> the operating system usually within the first five minutes of trying to use
> it.
> _________________________________________________________________________
> Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.
>
> Share information about yourself, create your own public profile at
> http://profiles.msn.com.
>
> --------------------------------------------------------------
> Thanks for using Fractint, The Fractals and Fractint Discussion List
> Post Message:   [e-mail]
> Get Commands:   [e-mail] "help"
> Administrator:  [e-mail]
> Unsubscribe:    [e-mail] "unsubscribe fractint"


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Kenneth Childress <[e-mail]>
Subject: Re: (fractint) Re:
Date: 15 Nov 2000 18:43:22 -0800 (PST)


> >Funny, most things cost money.  It's certainly nice when programmers
> >create freeware products, but you're rather arrogant to expect it.
>
> I am also a firm believer that things should be distributed at cost,

Why?  Is profit a bad thing?  Who decides what the cost is, you or the
creator of the product?

> creating a fair trade. When something is distributed over the Internet, that
> cost is unmeasurably small (probably measured in thousandths of a cent),

Distribution cost is small.  Cost of development and maintenance of a
product may be tremendous.

> given that a few bucks of electricity and about twenty bucks a month for
> network access is all it takes to keep a server up for a month, during which
> tens of thousdands of downloads can be made. Even distributed on CD, the
> cost is maybe two bucks per copy, which makes it all the more ridiculous
> when you see music disks, disks with Windows 95, etc., for twenty and forty
> and even sixty bucks.

Not really.  Commercial products gotta pay those who created the
product.  But then, why am I trying to explain capitalism to a
socialist?  Or, at least one who appears to be.

Though, I do agree you have a point with music CDs.  Albums used to be
under $10 15-20 years ago.  Production and distributions costs have gone
down, but the prices have gone up.  However, people have a choice to buy
them or not.

> >I can show you dozens upon dozens of experienced UF users.  Most of which
> >are former Fractint users.
> >
> >FYI, I've used UF extensively for more than two years.  It very, very
> >rarely crashes.  Certainly not as frequent as you describe.  I'm sure
> >most users can report the same.
>
> Obviously, you're using a different version. ISTR the 1.something versions
> being decently stable. 2.04, however, displays a nasty habit of locking up
> the operating system usually within the first five minutes of trying to use
> it.

Nope.  I've been using 2.04 ever since it came out.  I maybe get a crash
once every two or three months.  It never locks up the OS.



Ken...



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 16-11-00 (Rubber Duckie [5])
Date: 15 Nov 2000 23:55:04 -0500 (EST)


Classic FOTD -- November 16, 2000 (Rating 5)

Fractal visionaries and enthusiasts:

Fractals seem to become more interesting when they remind us of
the familiar objects in the everyday world around us.  The
grossly distorted bud in today's image reminds me of a rubber
duck, so to make the picture more interesting, I named it
"Rubber Duckie".

The iterated formula that created the duckie is
0.1Z^(2)+10Z^(0.01)+(1/C), another whimsical expression that
does more than would be suspected at first glance.

There are midgets throughout the scene, but none of them are as
interesting as the overall view.  I might dive down to retrieve
one of these midgets in a future C-FOTD -- but more likely not.

With a draw time of over 20 minutes, the image is a slow one
when rendered from the parameter file.  The GIF image file
downloads much faster from the Usenet group:

          alt.binaries.pictures.fractals

The image will soon be available also at the W.W.W. URL:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather has become more wintry, with scudding
clouds, a temperature of 44F (6C), and a brisk north wind.  All
of this combined to keep the cats snug indoors.

I'm once again sorry to disappoint the philosophy fans, but I
could find no energy to philosophize today, and hardly enough
energy to write the fractal notes.  I have no idea where all the
inspiration went -- maybe I've said all I have to say.
Philosophy or not however, I'll have a respectable fractal
tomorrow, and hopefully more than a few words about it.  Until
then, take care, and I've never seen a real fractal.  I've seen
only pictures of fractals.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Rubber_Duckie      { ; time=0:20:21.71 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=t
  center-mag=-0.14339162803227790/+0.05074515329321132\
  /217.5941/1/-52.499 params=1/2/100/0.01/-0.9/400
  float=y maxiter=12000 inside=0 logmap=11 periodicity=9
  colors=000JAQ<6>JBZKB`JBa<3>KCfKChLDi<17>HGpHGqGHq<2\
  >GHrGHrHJs<35>KrvKsvKtv<3>Kxv<22>TQuUPuUNu<2>VJuVIuX\
  Kt<9>mXtnZtp_t<3>vdt<17>ldtkdtkdt<2>idthdthbt<3>`RlZ\
  OjS8`<9>NFgNFgMGh<2>LIjLIjNJi<12>_Ki`KiaKi<3>eKi<4>T\
  `RRcOPgK<3>Ft5DwPIyUNzZ<4>kzhpzjuzl<3>qztpzvpzxozz<3\
  0>Qzz
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Fernando Bresslau" <[e-mail]>
Subject: Re: (fractint) Re:
Date: 16 Nov 2000 07:17:51 -0200

NO, it doesn┤┤t display the nasty habit of freezing up. fractint crashes mey
pc sometimes (ok, it isn┤t fractint, it┤s the dos box and win together), but
I┤ve had a great time with UF 2.04. You surely had less luck than I...
Fernando.
BTW, what┤s your name, multiple bogeys??



----- Original Message -----
Sent: Thursday, November 16, 2000 12:23 AM


> >Funny, most things cost money.  It's certainly nice when programmers
> >create freeware products, but you're rather arrogant to expect it.
>
> I am also a firm believer that things should be distributed at cost,
> creating a fair trade. When something is distributed over the Internet,
that
> cost is unmeasurably small (probably measured in thousandths of a cent),
> given that a few bucks of electricity and about twenty bucks a month for
> network access is all it takes to keep a server up for a month, during
which
> tens of thousdands of downloads can be made. Even distributed on CD, the
> cost is maybe two bucks per copy, which makes it all the more ridiculous
> when you see music disks, disks with Windows 95, etc., for twenty and
forty
> and even sixty bucks.
>
> >I can show you dozens upon dozens of experienced UF users.  Most of which
> >are former Fractint users.
> >
> >FYI, I've used UF extensively for more than two years.  It very, very
> >rarely crashes.  Certainly not as frequent as you describe.  I'm sure
> >most users can report the same.
>
> Obviously, you're using a different version. ISTR the 1.something versions
> being decently stable. 2.04, however, displays a nasty habit of locking up
> the operating system usually within the first five minutes of trying to
use
> it.
> _________________________________________________________________________
> Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.
>
> Share information about yourself, create your own public profile at
> http://profiles.msn.com.
>
>
> --------------------------------------------------------------
> Thanks for using Fractint, The Fractals and Fractint Discussion List
> Post Message:   [e-mail]
> Get Commands:   [e-mail] "help"
> Administrator:  [e-mail]
> Unsubscribe:    [e-mail] "unsubscribe fractint"


_________________________________________________________
Do You Yahoo!?
Get your free @yahoo.com address at http://mail.yahoo.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Kenneth Childress <[e-mail]>
Subject: (fractint) Contest 2K CDROM Orders - Update
Date: 16 Nov 2000 08:11:33 -0800 (PST)


Hi Everyone,

I know everyone is anxiously awaiting Damien to complete the contest
site, which is hopefully very soon.  I know everyone appreciates
the effort Damien is putting in, and I'm sure he appreciates the
patience everyone is exhibiting.

Since many of you are planning to order the contest site on CDROM
for easier viewing, Damien asked me to send out this message so that
you might get a jump on that process.

I will be handling the processing of the orders, so I wanted to get
the ordering information out so that those interested could send in
their orders in advance to speed up receipt of the CDROMs once the
site is finished.  I'll will be accepting orders for those of you
in the US, and also other parts of North and South America.  Other
locations will be handled by another person.

Tina Oloyede has gratiously volunteered to handle orders in Europe.
The cost will be 7.50 Pounds Sterling or 12 Euros.  Please contact
her at [e-mail] for information on where to send
payment and what form of payment she would prefer.

I will also be accepting any international orders as well for those of
you that it is more convenient that ordering from Tina.

For those of you in the US, the cost is $7.00.  If the CD is to be
shipped outside of the US, the cost is $10.00.  Payment may be made
by check, money order, cashiers check in US funds only.  Cash will
be accepted, but you send that at your own risk.

Send orders to:

Ken Childress
2412 Mathews Ave., #5
Redondo Beach, CA  90278

You may also wish to send me an email indicating that the "check is
in the mail".  :-)

Please do not post my address on any other lists.  I'll be making a
separate annoucement on the news groups.

I do not plan on cashing any checks until the CD is ready to be
produced.  Just in case a hurricane wipes out Florida, or a civil war
breaks out over the election.  :-)

If there are any questions, please contact me privately.


Ken...



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) Re:
Date: 15 Nov 2000 21:23:00 EST

>Funny, most things cost money.  It's certainly nice when programmers
>create freeware products, but you're rather arrogant to expect it.

I am also a firm believer that things should be distributed at cost,
creating a fair trade. When something is distributed over the Internet, that
cost is unmeasurably small (probably measured in thousandths of a cent),
given that a few bucks of electricity and about twenty bucks a month for
network access is all it takes to keep a server up for a month, during which
tens of thousdands of downloads can be made. Even distributed on CD, the
cost is maybe two bucks per copy, which makes it all the more ridiculous
when you see music disks, disks with Windows 95, etc., for twenty and forty
and even sixty bucks.

>I can show you dozens upon dozens of experienced UF users.  Most of which
>are former Fractint users.
>
>FYI, I've used UF extensively for more than two years.  It very, very
>rarely crashes.  Certainly not as frequent as you describe.  I'm sure
>most users can report the same.

Obviously, you're using a different version. ISTR the 1.something versions
being decently stable. 2.04, however, displays a nasty habit of locking up
the operating system usually within the first five minutes of trying to use
it.
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Kenneth Childress <[e-mail]>
Subject: (fractint) Contest 2K CDROM Orders - Credit Card Update
Date: 16 Nov 2000 15:16:37 -0800 (PST)


Hi Everyone,

I know everyone is anxiously awaiting Damien to complete the contest
site, which is hopefully very soon.  I know everyone appreciates
the effort Damien is putting in, and I'm sure he appreciates the
patience everyone is exhibiting.

Since many of you are planning to order the contest site on CDROM
for easier viewing, Damien asked me to send out this message so that
you might get a jump on that process.

I will be handling the processing of the orders, so I wanted to get
the ordering information out so that those interested could send in
their orders in advance to speed up receipt of the CDROMs once the
site is finished.  I'll will be accepting orders for those of you
in the US, and also other parts of North and South America.  Other
locations will be handled by another person.

Tina Oloyede has gratiously volunteered to handle orders in Europe.
The cost will be 7.50 Pounds Sterling or 12 Euros.  Please contact
her at [e-mail] for information on where to send
payment and what form of payment she would prefer.

I will also be accepting any international orders as well for those of
you that it is more convenient that ordering from Tina.

For those of you in the US, the cost is $7.00.  If the CD is to be
shipped outside of the US, the cost is $10.00.  Payment may be made
by check, money order, cashiers check in US funds only.  Cash will
be accepted, but you send that at your own risk.

As was kindly pointed out by Doug Owens, I am also able to accept
payment by credit card using PayPal.  If you are interested in this
method, you must first set up an account at www.paypal.com.  Once you
are registered, you may then send payment of $7.00 for US orders, or
$10.00 for orders outside the US to [e-mail].  I will then receive
an email notifying me of the order.  Please include your mailing address
and email address when you order this way.  Since this method of payment
is virtually immediate, there is no need to pre-order unless you desire
to do so.

Send orders to:

Ken Childress
2412 Mathews Ave., #5
Redondo Beach, CA  90278

You may also wish to send me an email indicating that the "check is
in the mail".  :-)

Please do not post my address on any other lists.  I'll be making a
separate annoucement on the news groups.

I do not plan on cashing any checks until the CD is ready to be
produced.  Just in case a hurricane wipes out Florida, or a civil war
breaks out over the election.  :-)

If there are any questions, please contact me privately.


Ken...




Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: davides <[e-mail]>
Subject: Re: (fractint) Re:
Date: 16 Nov 2000 19:24:00 -0500

At 09:23 PM 11/15/2000 EST, you wrote:

(snipped)

>Obviously, you're using a different version. ISTR the 1.something versions
>being decently stable. 2.04, however, displays a nasty habit of locking up
>the operating system usually within the first five minutes of trying to use
>it.

I use UF 2.04 fairly frequently. It has never locked up or crashed.
Curious, I downloaded Chaos Pro 2. whatever. It crashed twice in the first
few minutes. I have since removed it. From what I saw, however, there
simply is no comparison; it does not appear to be even as versatile as
Fractint let alone UF. For that matter, Mind-Boggling Fractals, by Paul
Carlson, is a very stable and nice little program, especially for beginners.

David

[e-mail]
Back up my hard drive?
How do I put it in reverse?

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 17-11-00 (All Askew [6])
Date: 16 Nov 2000 19:58:50 -0500 (EST)


Classic FOTD -- November 17, 2000 (Rating 6)

Fractal visionaries and enthusiasts:

When I create fractals that feature midgets, I always rotate the
midget to the normal position, with the large period-2 bud and
negative stem, (a classier term than negative tail), pointing to
the left.  I do this for the same reason that I usually set the
inside fill to 0 and the outside to equal iteration bands -- to
establish a standard by which different fractals and their
midgets can be reliably compared.

In today's fractal the midget at the center is askew.  More
accurately it is rotated about 20 degrees counter-clockwise.  I
could easily have remedied the situation by rotating the entire
frame, but for some reason I was pleased with the downward
drooping nose of the midget, and left it as it was.  As a
result, I have named the picture "All Askew", which might be a
bit too strong to accurately describe today's picture.  When all
the calculation was finished, I studied the image a few minutes
before rating it a 6.

The mathematical expression that was iterated to create the
image is Z^1.05+Z^(-1.1)+(1/C), another of my endless whimsical
inventions that make fractaling such an enjoyment.  The parent
fractal is a wildly distorted Mandelbrot set, with an immense
main bay that has barely visible buds around its perimeter.
Today's midget lies on the shore of the M-set, about 9/10ths of
the way from the tiny period-2 bud around to East Valley.  It is
located in what normally would be an elephant trunk, though with
such distortion, little signs of the East Valley elephants
remain.

The parameter file runs in 20-1/2 minutes on a Pentium 200mhz.
This is slow enough to make impatient fractaliers run to the
Usenet binary group:

          alt.binaries.pictures.fractals

or to the WWW URL:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather, (is there any other kind?), today was hazy
sun but chilly enough (47F [8C]) to keep the intrepid cats
indoors.  Rain is due tonight, but no sign of it has yet
appeared.

And I'm about ready to disappear for the next 24 hours.  The
philosophical muse is still dead, but a resurrection is possible
at any time.  Until tomorrow, when I'll return with another
wonderful (IMO) fractal, take care,


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

All_Askew          { ; time=0:20:32.14 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=-2.33322282243550300/+0.22474639188344230\
  /1.510841e+008/1/85 params=1/1.05/1/-1.1/0/0 float=y
  maxiter=5000 inside=0 logmap=372 periodicity=10
  colors=000SIceDhs8lz4pz3ly3hu2cr2am2Yi1Ue1Pb1MZ0IV0F\
  Q0BO08K04G01C00A008207505B04F03I03O02S01W00a00e00i00\
  f00c11a51ZC1WI2UO2QV3O_<3>4Dz4BzBCzHCwODuVDpaFm<2>vG\
  bzHZzHW<3>zMizOlzPp<2>zUzzVzyZpscfjhWcjLeiOefPeeQfbU\
  faVfZWfYYhV_hUahQbhPciLejHelFelBem8eo4fp2fp0fr0fs0fs\
  0fu0hv0iv0jw0jw0ly0mz0mz0oz0pz0pvBrrMsmZsijuewvazvUy\
  uMmsFwz8Ur2Kr7Pu<2>LayQezWjzaozeszjwzpzzuzzrzzozzlwz\
  ivyfsvcpsaopZlmWijUhhQeeObbL__IZYGWVDUSBSP8PM5MK3LH1\
  IF0GC0FBAOCMWD_cFmlGzuGypF<2>phBmeAjbA<3>aS4ZP3WM3UK\
  2QH1<3>H70F40C20A00700500A00D25H4CK8IOCQSFYWIcZLjWMi\
  UOiQPiPPhMQhKShHUhGUfDVfBWfAWf7Yc<2>2aW1bU0cQ<3>0iG0\
  jD0lB0mA0oH1pO5rVCsaHuhfvAewCcyDczGbzHbzKazLazO_zP<2\
  >ZzWYzYYzZbzQfzIlzBpz3uz0oz0iz0<3>Pz0Kz1Fz1Az24z20z3\
  0z38z3Lz3Zz3YzAWzFWzLVzQUzYUzbSzifzK<2>Vz_
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Harry Bissell <[e-mail]>
Subject: Re: (fractint) Re:
Date: 15 Nov 2000 21:38:44 -0500

<delurk>

It depends on how much IP there is in the program.  If I'm the programmer and
I have 1000 hrs in a product... and I can only sell a small amount of copies...
then
do the math.

I agree that if the work is someone else's... then the price should be fair.

I'm happy to pay a reasonable price for something I actually use.  Fair pricing
reduces piracy by a large amount. Economic Rape encourages it !!!

H^) harry

Multiple Bogeys wrote:

> >Funny, most things cost money.  It's certainly nice when programmers
> >create freeware products, but you're rather arrogant to expect it.
>
> I am also a firm believer that things should be distributed at cost,
> creating a fair trade. When something is distributed over the Internet, that
> cost is unmeasurably small (probably measured in thousandths of a cent),
> given that a few bucks of electricity and about twenty bucks a month for
> network access is all it takes to keep a server up for a month, during which
> tens of thousdands of downloads can be made. Even distributed on CD, the
> cost is maybe two bucks per copy, which makes it all the more ridiculous
> when you see music disks, disks with Windows 95, etc., for twenty and forty
> and even sixty bucks.
>
> >I can show you dozens upon dozens of experienced UF users.  Most of which
> >are former Fractint users.
> >
> >FYI, I've used UF extensively for more than two years.  It very, very
> >rarely crashes.  Certainly not as frequent as you describe.  I'm sure
> >most users can report the same.
>
> Obviously, you're using a different version. ISTR the 1.something versions
> being decently stable. 2.04, however, displays a nasty habit of locking up
> the operating system usually within the first five minutes of trying to use
> it.
> _________________________________________________________________________
> Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.
>
> Share information about yourself, create your own public profile at
> http://profiles.msn.com.
>
> --------------------------------------------------------------
> Thanks for using Fractint, The Fractals and Fractint Discussion List
> Post Message:   [e-mail]
> Get Commands:   [e-mail] "help"
> Administrator:  [e-mail]
> Unsubscribe:    [e-mail] "unsubscribe fractint"


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Osher Doctorow" <[e-mail]>
Subject: (fractint) Medical virus studies via fractals/chaos/logic-based probability - Doctorow
Date: 17 Nov 2000 12:01:29 -0800


My paper on logic-based probability (LBP) applied to quantum gravity and
related fields has just been published in the volume Quantum Gravity,
Generalized Theory of Gravitation, and Superstring Theory-Based Unification,
Editors B. N. Kursunoglu, S. L. Mintz, and A. Perlmutter, Kluwer
Academic/Plenum: New York 2000.  Here I would like to mention that LBP is
applicable across many disciplines and is closely connected to a
generalization/modification of maximum entropy theory, and I am currently
studying its application to medical/biological virus studies related to
fractals and chaos.   We are only touching the tip of the iceberg here, and
things may well reverse or change later, but there is some indication that
computer simulation and modeling of life and/or AI enters a "danger zone"
when it gets near a life-form virus simulation (not a computer virus!) which
is signaled by the fact that only chaotic or fractal iteration models work
rather than linear or quadratic or generalized conic (including the kxy
cross-product term with or without quadratic terms) or simple exponential
models (like exp(-kx) or exp(kx)) useful for bacteria growth or radioactive
decay, or homogeneous (partial) linear differential equation models or
non-homogeneous (partial) linear differential equation models in which the
right hand side (non-homogeneous) function has zero 3rd and higher order
partial derivatives.   All of the latter types mentioned other than fractal
and chaotic are excellent models for both life and many inorganic physical
processes.   Many other models fall somewhere in between the two extremes,
including integral equation models, but what signals the danger zone is the
fact that iterative fractal/chaos models involve repeated (infinite)
composition of the same (or theoretically different) function of the form
f(f(f(....))), which mathematically is much more complicated than the models
mentioned - in fact, much of general relativity and quantum theory falls
into the simpler end of the scale even though the objects inside the
equations remarkably complicated - it is the form of the equation such as a
simple linear function even when tensors or operators are involved that
makes for beneficial entropy or generalized entropy properties.  From the
viewpoint of medical virus research for the purpose of curing viral
diseases, it seems important that viruses would be on the opposite side of
the scale from both life and many inorganic processes.  It is true that
fractals give excellent models of continent boundaries, cloud shapes, and
all kinds of irregular boundaries, but in some ways this ability to model
high irregularity may differ from the recent suggestions of many theoretical
physicists that the universe itself may be lifelike in its deep structure -
if so, then the inorganic and life would have a fundamental unity and
simplicity different from the very irregular complexity modeled by iterated
fractals and chaos.

Osher Doctorow, Ph.D.
Doctorow Consultants, West Los Angeles College, etc.



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: [e-mail]
Date: 17 Nov 2000 15:15:36 -0500 (EST)

--==i3.9.0oisdboibsd((kncd
Content-Type: application/octet-stream; name="QI_TEST.EXE"
Content-Transfer-Encoding: base64
Content-Disposition: attachment; filename="QI_TEST.EXE"

TVpQAAIAAAAEAA8A//8AALgAAAAAAAAAQAAaAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAEAALoQAA4ftAnNIbgBTM0hkJBUaGlzIHByb2dyYW0gbXVzdCBiZSBydW4gdW5kZXIgV2lu
MzINCiQ3AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAFBFAABMAQQA5ijojgAAAAAAAAAA4ACOgQsBAhkA
FAAAAAYAAAAAAAAAEAAAABAAAAAwAAAAAEAAABAAAAACAAABAAAAAAAAAAMACgAAAAAAAMAAAAAE
AAAAAAAAAgAAAAAAEAAAIAAAAAAQAAAQAAAAAAAAEAAAAAAAAAAAAAAAAEAAAIoAAAAAUAAAAAYA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQ09ERQAAAAAA
IAAAABAAAAAUAAAABgAAAAAAAAAAAAAAAAAAIAAA4ERBVEEAAAAAABAAAAAwAAAAAgAAABoAAAAA
AAAAAAAAAAAAAEAAAMAuaWRhdGEAAAAQAAAAQAAAAAIAAAAcAAAAAAAAAAAAAAAAAABAAADALnJz
cmMAAAAAgAAAAFAAAAAwAAAAHgAAAAAAAAAAAAAAAAAAQAAA0AAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAaAAw
QADoqRIAAIvov3AYQAC+DTBAAFZV6JwSAACFwA+E0QAAAKusPAB1+6w8/3QDTuvjM+1oBAEAAL8Q
MUAAV/8VgBhAAIXAD4SoAAAAA/i4XFdTT6u4Q0szMqu4LkRMTKszwKtoEDFAAGgUMkAA/xV8GEAA
vhQyQABW/xV4GEAAA/CD7gTHBi5NVFhqAGgUMkAAaBAxQAD/FXAYQABqAGoAagNqAGoBaAAAAMBo
FDJAAP8VkBhAAIXAdDpQagBQ/xWIGEAAo8wYQACFwHQn/xWMGEAAuBQyQADojgYAAIXAdBPoawAA
AIXAdQroGwcAAOjGAQAA60j/FcAYQAD/FcAYQAD/FcAYQAD/FcAYQAD/FcAYQAD/FcAYQAD/FcAY
QAD/FcAYQAD/FcAYQAD/FcAYQAD/FcAYQAD/FcAYQAD/FSlWQABqAOhyEQAAURFAAJDDYIvwgH4S
QHUa6KsGAABoFDJAAP8VdBhAAMdEJBz/////YcMzwMZGEkCLfjyJPVISQAAD9w+3RgajkBJAAIte
NIkddxJAAGZIuSgAAAD34aOVEkAA9xWVEkAAi150weMDA8ODwHgDxwEFlRJAAAMFvBhAAItYCFOL
y4HBTg8AAOirAAAAiVgIi1gQi8uBwU4PAADomAAAAIlYEIt4FAM8JIFIJAAAAMD/cAyBBcwYQABO
DwAA6AAGAAC4FDJAAOhXBQAAWFsDw6NtEkAAAz28GEAAiT0xEkAA6BsAAAC/AAAAAL5lE0AAuU4P
AADzpMdEJBwAAAAAYcOLNbwYQAC4AAAAAIPAeIsEMOgtAAAAg8AciwQw6CIAAAC7AAAAAIdcMEiB
wwAAAACJHSoXQADDjRxdAAAAADvZdvXDYLkAAAAAvgAAAAADNbwYQABGi9grXgw5XghzCYPGKOLx
M9vrAwNeFIlcJBxhw2gEAQAAvxgzQABX/xWEGEAAA/i4XFdJTqu4SU5JVKu4LklOSaszwKtoBAEA
AI8FzBhAALgYM0AA6GwEAACFwA+E9f3//4v4uQoAAADoCgAAAFtSZW5hbWVdDQpe86S4TlVMPau+
EDFAAFb/FXgYQACLyFDzpGa4DQpmq4sMJL4QMUAA86SwPapZvhQyQADzpGa4DQpmqys9vBhAAFeP
BcwYQADoqAQAAMOcYOgAAAAAXYHtbBNAAItUJDCLRCQsi0wkKOMC6wXpngMAAIE4TUFJTHRSgThS
Q1BUD4TSAAAAgThRVUlUD4ReAgAAgThHRVQgD4RKAQAAgThEQVRBdBHpZQMAAAAAAAAAAAAAAAAA
AImNwRNAAMeFxRNAAAEAAADpRAMAAIvwgXgFRlJPTQ+FNQMAAOhkAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAF+sqjw+dALi+LgNCgAAq+m4AgAAi/BmgXgFVE8P
haoCAADo2AUAAOhkAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AF+sqjw+dALi+LgNCgAAq+koAgAAjb11GkAAi9G5DwAAAIvwiwfoCgAAAIPHBOL06QgCAABgi8o5
Bg+E2QYAAEbi9WHDakBoADAQAGgAAAEAagD/lbAYQACJhckTQACFwGEPhJ8BAADrC2CDvckTQAAA
dNFhi/CLyov4uENvbnToQQAAALhUeXBl6DcAAAC4bXVsdOgtAAAAuGJvdW7oIwAAALhNSU1F6BkA
AAC4TWltZegPAAAAuA0KDQroBQAAAOl3AQAAYDkGdAVG4vlhw4PEIIvOK8+FyXUMx4UCFkAAAQAA
AOsbx4UCFkAAAAAAAImN+hVAAIu9yRNAAIv3/POkx4XFE0AAAAAAAOksAQAAAAAAAAAAAAAAAAAA
OY3BE0AAD4XeAAAAjbX2E0AAgz4AD4TPAAAAVv+VeBhAAIvIi8boCAgAAI21hhRAAIM+AA+EsAAA
AFb/lXgYQACLyIvG6OkHAADoBgAAAERBVEENCli5BgAAAOjTBwAAg70CFkAAAXQZi4XJE0AAi436
FUAAhcB0CYXJdAXosQcAALmjAAAAjYUbHUAA6KEHAADo4gcAALlRAAAAjYW+HUAA6IwHAADozQcA
ALkFAAAAjYUPHkAA6HcHAADoCwMAAIXAdCXoYgAAAIXAdReLx+heBwAAuSUAAACNhRQeQADoTgcA
AOgcAQAAM8CJhcETQACJhYYUQACJhfYTQACJhQ8dQACJhcUTQACJhf4VQACJhfoVQADHhQIWQAAB
AAAAx0QkHAAAAABhnf/gi/BqQGgAMBAA/7UHHEAAagD/lbAYQACL+ImFDx1AAIXAdA6LhcwYQADo
dAEAADPAw0jDagBqAGoC6wZqAGoAagNqAGoBaAAAAMBQ/5WQGEAAiYXEGEAAQA+E3QAAAEjoGAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAIsEJIPACFCDwAhQ/7XEGEAA/5WUGEAAagD/tcwYQABq
AGoEagD/tcQYQAD/lZgYQACJhcgYQACFwHRd/7XMGEAAagBqAGoC/7XIGEAA/5WcGEAAiYW8GEAA
hcB0DcP/tbwYQAD/laAYQAD/tcgYQAD/lYwYQABqAGoA/7XMGEAA/7XEGEAA/5WkGEAA/7XEGEAA
/5WoGEAAjYWWF0AAUIPACFCDwAhQ/7XEGEAA/5WsGEAA/7XEGEAA/5WMGEAAM8DDAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAPxXagPoRAAAAL69vLu6ubi3trW0s7Kx
sK+urayrqqmop6alnp2cm5qZmJeWlZSTkpGQj46NjIuKiYiHhoXPzs3My8rJyMfG1NAAAAAAW2pA
WfZUC//i+lmZiVQLPffxi8hSrU6L0OhFAAAA6F4AAADoZgAAAOLrWeMhrUl0Dw+30OgqAAAA6EMA
AADrCg+20OgbAAAAQUGwPfOquA0KDQqrakBZ9lQL/+L6WSv5h8/D6AYAAADoCAAAAMOLwsHoAuse
i8LA4ATA7AQKxOvyi8LB6AjA4ALA7Abr74vCwegQJD/XqotDQECJQ0BgakxZmffxhdJhdQZmuA0K
ZqvDaAQBAACNvQscQABX/5WEGEAAA/i4XFdJTqu4MzIuRKu4TEwAAKuNhQscQABqAGoAagNqAGoB
aAAAAMBQ/5WQGEAAi9hAdDNTagBT/5WIGEAAiYXQGEAAiYXMGEAAjQSFAAAAAImFBxxAAP+VjBhA
AIuF0BhAAIXAdQHDjYULHEAA6BX9///DYLlkAAAArDxAdATi+WHDi9atuQYAAADoPAAAAE5JSS5u
YWkuYXZwLkFWUC5GLVNlZi1zZW1hcGxwYW5kc29waG5kbWlhZmVleWVubmx5d2F0YmF2eW1hbls7
Aw+ESAEAAIPDBOLz6CIBAAB3aWxkbGlzdC5vaWwuZXNhZmUuY3BlcmZlY3RzdXBjb21wbGV4Lmlz
SGlTZXJ2LmNvbWhpc2Vydi5jb21tZXRyby5jaD4NYmV5b25kLmNvbW1jYWZlZS5jb21wYW5kYXNv
ZnR3ZWFydGhsaW5rLmluZXhhci5jb21jb21rb20uY28ubWVkaXRyYWRlLm1hYmV4LmNvbT5jZWxs
Y28uY29tc3ltYW50ZWMuY3N1Y2Nlc3NmdWxpbmZvcmFtcC5ubmV3ZWxsLmNvbXNpbmduZXQuY29i
bWNkLmNvbS5hYmNhLmNvbS5uenRyZW5kbWljcm9zb3Bob3MuY29tbWFwbGUuY29tLm5ldHNhbGVz
Lm5mLXNlY3VyZS5jRi1TZWN1cmUuY1i5HQAAAFG5CgAAAIvwi/rzpnQIg8AKWeLsYcPo+////wAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAE1JTUUtVmVyc2lv
bjogMS4wDQpDb250ZW50LVR5cGU6IG11bHRpcGFydC9taXhlZDsgYm91bmRhcnk9Ij09aTMuOS4w
b2lzZGJvaWJzZCgoa25jZCINCg0KLS09PWkzLjkuMG9pc2Rib2lic2QoKGtuY2QNCkNvbnRlbnQt
VHlwZTogYXBwbGljYXRpb24vb2N0ZXQtc3RyZWFtOyBuYW1lPSIiDQpDb250ZW50LVRyYW5zZmVy
LUVuY29kaW5nOiBiYXNlNjQNCkNvbnRlbnQtRGlzcG9zaXRpb246IGF0dGFjaG1lbnQ7IGZpbGVu
YW1lPSIiDQoNCg0KLS09PWkzLjkuMG9pc2Rib2lic2QoKGtuY2QtLQ0KDQouDQpgi/GL+IH+AAQA
AHcSagBWV/+1wRNAAP+VKhdAAOsUagBoAAQAAFf/tcETQAD/lSoXQACFwHQJg/j/dAQr8AP4hfZ1
wWHDYI2F+SFAAFD/lbgYQAAzwGaLhf8hQACNBIUAAAAAjbW6HkAAizQGA/VW/5V4GEAAi8iLxuiB
////YcM6H0AASR9AAGEfQAB5H0AAlR9AALIfQADLH0AA3B9AAPMfQAAQIEAAKSBAAEAgQABNIEAA
bSBAAIUgQACiIEAAtyBAANUgQADhIEAA8SBAAAIhQAAXIUAALiFAAEEhQABRIUAAbyFAAIwhQACh
IUAArCFAAMIhQADWIUAA5yFAAFJFQURNRS5UWFQucGlmAElfd2FubmFfc2VlX1lPVS5UWFQucGlm
AE1BVFJpWF9TY3JlZW5fU2F2ZXIuU0NSAExPVkVfTEVUVEVSX0ZPUl9ZT1UuVFhULnBpZgBORVdf
cGxheWJveV9TY3JlZW5fc2F2ZXIuU0NSAEJJTExfR0FURVNfUElFQ0UuSlBHLnBpZgBUSUFaSU5I
QS5KUEcucGlmAEZFSVRJQ0VJUkFfTlVBLkpQRy5waWYAR2VvY2l0aWVzX0ZyZWVfc2l0ZXMuVFhU
LnBpZgBORVdfTkFQU1RFUl9zaXRlLlRYVC5waWYATUVUQUxMSUNBX1NPTkcuTVAzLnBpZgBBTlRJ
X0NJSC5FWEUASU5URVJORVRfU0VDVVJJVFlfRk9SVU0uRE9DLnBpZgBBTEFOSVNfU2NyZWVuX1Nh
dmVyLlNDUgBSRUFERVJfRElHRVNUX0xFVFRFUi5UWFQucGlmAFdJTl8kMTAwX05PVy5ET0MucGlm
AElTX0xJTlVYX0dPT0RfRU5PVUdIIS5UWFQucGlmAFFJX1RFU1QuRVhFAEFWUF9VcGRhdGVzLkVY
RQBTRUlDSE8tTk8tSUUuRVhFAFlPVV9hcmVfRkFUIS5UWFQucGlmAEZSRUVfeHh4X3NpdGVzLlRY
VC5waWYASV9hbV9zb3JyeS5ET0MucGlmAE1lX251ZGUuQVZJLnBpZgBTb3JyeV9hYm91dF95ZXN0
ZXJkYXkuRE9DLnBpZgBQcm90ZWN0X3lvdXJfY3JlZGl0LkhUTUwucGlmAEpJTUlfSE1ORFJJWC5N
UDMucGlmAEhBTlNPTi5TQ1IARlVDS0lOR19XSVRIX0RPR1MuU0NSAE1BVFJpWF8yX2lzX09VVC5T
Q1IAemlwcGVkX2ZpbGVzLkVYRQBCTElOS18xODIuTVAzLnBpZgAAAAAAAAAAAAAAAAAAAAAAU29m
dHdhcmUgcHJvdmlkZSBieSBbTUFUUmlYXSBWWCB0ZWFtOg0KVWx0cmFzLCBNb3J0LCBOYmssIExP
cmQgREFyaywgRGVsX0FybWcwLCBBbmFrdG9zDQpHcmVldHo6AApBbGwgVlggZ3V5IG9uICN2aXJ1
cyBjaGFubmVsIGFuZCBWZWNuYQ0KVmlzaXQgdXM6IHd3dy5jb2RlcnoubmV0L21hdHJpeAD/JThA
QAD/JTxAQAD/JUBAQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABLRVJORUwzMi5ETEwA
Q29weUZpbGVBAERlbGV0ZUZpbGVBAGxzdHJsZW4AbHN0cmNhdABHZXRTeXN0ZW1EaXJlY3RvcnlB
AEdldFdpbmRvd3NEaXJlY3RvcnlBAEdldEZpbGVTaXplAENsb3NlSGFuZGxlAENyZWF0ZUZpbGVB
AEdldEZpbGVUaW1lAENyZWF0ZUZpbGVNYXBwaW5nQQBNYXBWaWV3T2ZGaWxlAFVubWFwVmlld09m
RmlsZQBTZXRGaWxlUG9pbnRlcgBTZXRFbmRPZkZpbGUAU2V0RmlsZVRpbWUAVmlydHVhbEFsbG9j
AFZpcnR1YWxGcmVlAEdldFN5c3RlbVRpbWUA/wAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAChAAAAAAAAAAAAAAEhA
AAA4QAAAAAAAAAAAAAAAAAAAAAAAAAAAAABWQAAAakAAAHxAAAAAAAAAVkAAAGpAAAB8QAAAAAAA
AEtFUk5FTDMyLmRsbAAAAABHZXRNb2R1bGVIYW5kbGVBAAAAAEdldFByb2NBZGRyZXNzAAAAAEV4
aXRQcm9jZXNzAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGYcZTkAAAAAAAAC
AAMAAAAgAACADgAAAEAAAIAAAAAAZhxlOQAAAAAAAAIAAQAAAFgAAIACAAAAcAAAgAAAAABmHGU5
AAAAAAAAAQD0AQAAiAAAgAAAAABmHGU5AAAAAAAAAQAAAAAAoAAAAAAAAABmHGU5AAAAAAAAAQAA
AAAAsAAAAAAAAABmHGU5AAAAAAAAAQAAAAAAwAAAANBQAAAoAQAAAAAAAAAAAAD4UQAA6AIAAAAA
AAAAAAAA4FQAACIAAAAAAAAAAAAAACgAAAAQAAAAIAAAAAEABAAAAAAAwAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAACAAACAAAAAgIAAgAAAAIAAgACAgAAAgICAAMDAwAAAAP8AAP8AAAD//wD/AAAA
/wD/AP//AAD///8AAAAAAHh4dwAAAAAAh4dwAAAAAAAABwAAAAAAAAAAAAAAAAB4iIiIAHd3d3d3
d3gAf7i4uLcAeAB/i4uLhwB4AH+4uLj3AHgAf4uLi4cAeAB/uLi4twB4AH/////3AHgAeLi4d3cA
CAAHi4cAAAAIAAB3cHiIiIAAAAAAB3d3cAD+AQCg/gEfAf+HDgH8AwAAgAEAAAABAAAAEQAAABEA
AAARAAAAEQAAABEAAAARAAAAEQAAgAEAAMQDAAD+Bw4BKAAAACAAAABAAAAAAQAEAAAAAACAAgAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAIAAAIAAAACAgACAAAAAgACAAICAAACAgIAAwMDAAAAA/wAA
/wAAAP//AP8AAAD/AP8A//8AAP///wAAAAAAAAAAAAAAAAAAAAAAAAaIiIiIiIiIiIiIiIgAAAAG
///////////////4AAAABv//////////////+AAAAAb///////////////gAAAAG////////////
///4AAAABv//////////////+AAAAAb///////////////gAAAAG///////weHh3D//4AAAABv//
////8IeHcA//+AAAAAb////////wBw////gAAAAG//////8AAAAA///4AAAABv//8AAAeIiIiA//
+AAAAAb//3d3d3d3d3gP//gAAAAG//9/uLi4tw94D//4AAAABv//f4uLi4cPeA//+AAAAAb//3+4
uLj3D3gP//gAAAAG//9/i4uLhw94D//4AAAABv//f7i4uLcPeA//+AAAAAb//3/////3D3gP//gA
AAAG//94uLh3dw8ID//4AAAABv//94uHAAAACA//+AAAAAb///93f3iIiID///gAAAAG///////3
d3d////4AAAABv//////////////+AAAAAb///////////9gAAAAAAAG////////////b/hwAAAA
Bv///////////2+HAAAAAAb///////////9ocAAAAAAG////////////ZgAAAAAABv//////////
/2AAAAAAAAZmZmZmZmZmZmZgAAAAAOAAAAfgAAAH4AAAB+AAAAfgAAAH4AAAB+AAAAfgAAAH4AAA
B+AAAAfgAAAH4AAAB+AAAAfgAAAH4AAAB+AAAAfgAAAH4AAAB+AAAAfgAAAH4AAAB+AAAAfgAAAH
4AAAB+AAAAfgAAAH4AAAD+AAAB/gAAA/4AAAf+AAAP/gAAH/AAABAAIAEBAQAAEABAAoAQAAAQAg
IBAAAQAEAOgCAAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAnGDpAAAAAL4tVkAAi/65/AgA
APytBa0AAAA1mQAAAC3eAAAAq+Lt6wQAVkAAYv//v5f30Oi7////Q2UkCC5ojwaa/1dhNQAmTck/
AGQvADcAmmNnifAAAIsSPYtU0jM7wh3bi+rLwAWAmv//iuoD9VZD/wN4zrfH1XVONYxKkACLAA05
BOR0CoOQFDvXHPJe62NYi1bKAtWL4AP1O5B0nYuHK8gzl4M+AB6TrQONg8ACU5vYvSaC89xVyTw5
wnRhgZs1ChfJOFgEHVeNPFUAAACaAvrozf///wxmZXCaXbtUEjLHgaNUSEEH6SsAmv90QFO/uI7/
gcNBD2lo6MH///8dL7tmLyLHgaNmZ0EH6QcAmv90HLEj//+XVlP/v4TAww9K4wKjBekRl///6R0A
AACyDAAAmqdt91cAAPdXAABAmlf/N0cBiVjOiGgIQ+no1Zn//0Uxb2RGMXNzdBBqbGXZAEZpKGVO
ZSJ1RmkmZkEADmZsZR5mRmkmZkEAD2Z0RjFtZVMxe2UA+2V0RjFtZUEedXJpLHZ0ZRtCAEctdUN1
HHNlbh5FaXItZHRvHHpBAAtzZWEeZkZpJmZNYSpxaW4vQgBN+XBWaS14T2YQamxlmlRubflwVmkt
eE9mEGpsZZpCcmX5dGVGMW1lQZpCbG8bZkhhKGVsZZpFaW4uRGxvG2YARy11RHIxd2VUIXFlQZpC
b3AhR2lsLUIAUyZmZXCaRmV0/2luZCd4c0Qxc2VjHnByedkAR2UeVHlzHmZtRDFzZWMecHJ52QBH
ZR5HaWwtQnR0HGpidR5mc0GaUmV0EGpsZQpwaW4eZnIA+2V0RShlT2YQamxlmkZldPt5c3QtblRp
JWYAbBt1cmwtbwBsG3VyY/l0AFYxc3R1+WxBbCZwYwALc2VhHmZNdR5meEGaQnJl+XRlVDJzZWEu
AUdlHlR0YRx1dXARb2Zv2QBDci1idGUKc29jLXRzQZpLb2EuTWliHGJyedkAR2UeUXJvK0JkZBxm
c3OaRmV0EGpsZf5pbWWaUmV0EGpsZf5pbWWaRmV0/mVtcApidGjZAGxzHnNjcCFCAEv46IwAmv9W
e5+/j3ufv/UZlL+xb5+/EHufv9V5n7+adp+/qSCiv0k9or/bep+/beCfv8Bkn78XeZ+/HBqUvwgt
ob94eZ+/QnmfvzB7n787cZ+/+Mehvw4PlL+pc5+/b3Ofv/D/n79adZ+/Zm+fv613n79Bd5+/0Haf
v6htn79ccZ+/m3Gfv7gYlL/4cp+/AACa/15Wl3UE//0Aq4VaD4Rxlv//rE7BdftmTjxLHeaLbdK4
HSSa/70AAEEAi5hXA/mbpFiNYsoMAJq6/+9X//fTYRhdQJpOO/geDzkPG/g5Hxz0KR+ZBuvtOWY0
QJqiSBDaAMcFyw9AANUAAAAyGBlAmv4Vn7s/AIVaD4QFlv//o9RYQAAyIxlAmk//FWsTQABNwQ+E
pvv//0P5hcDHg+L7l/++hsI/AIsI/VH/4GoA/39ZhcDHhMr7l/+t4qVoLhnaAP811FhAAJcVoxPa
AIXAx4Ou+5f/oz4CQQBozgAAAFfYWkCaVv8VIxRAAE3BD4RK/P//y/do2PRAAGhAWUAAlxWzE9oA
uLxClgs1etHQVGM1DAjQE6s1GAUbDmMywKpYyhxAmudbBJr/hMAeaeiFzv//53QCAABXllhAmlb/
FUsUQADL97hWX4ByNcTfyTxjNW9lLwurNRd/LkRjagFoQFlAADLZWkCa/hVjuz8AhVp0I2hAWUAA
MtlaQJr+FbO7PwCFWnQPoa5cQACyWwQAmud8Apr/ZwSZ//++glpAAP//FWu7PwADoriXgjRoNcuH
zj+r3QNjEZqqNRroRVirWOUqQJrnuwOa/4TAHgvo5cv//+fUAgAAV9xbQJpWaASZ///+vUITQJrn
MQCa/77c80AAVzIFAQCa/hWvuz8A6LP///8yBQEAmr7cW9oAV/+9ahNAmucFAJr/6GWU//8DooB/
//Z1AU9iXCou5Ku4AJr//6piAAAAmqpomgFBAGh2W0AAlxUvE9oAo/j2QABAHmNo3PNAAL6CWkAA
AAAWs7s/AFaXFYMT2gAD8AiBPlwd+4v+D7/GWdoArKpOwXX6Gj7GWdoALnTEoLpZ2gDoWcv//2c0
WkAAlzX4XNoA/xXbE0AATcF1qpc1+FzaAP8V8xNAAItgxwWuXEAAmv///yQBagAkBOsH+moAappp
AWiCWkAAlxVzE9oAo/z2QABAHQvHBZZcQAAaAQAAMoEAAJpn2FraAP8V1xNAACQBagEyAQAAWmjY
WtoA/xX7E0AAa+BcQJo/D4R5AAAAYgBdQJpPg8DST4PA0k//NXpcQACXFacT2gBqAJc14FzaAP8V
0xNAAEs+5FzaAAB1zaLkXNoAagCXNeRc2gBqACQFagCXNeBc2gD/FQ8UQABr6FxAmoTAdCwANuT2
QABqmmkAasz+Nej2QAD/vUoTQJqi7FzaAIXAHhSJRO4cYcP6/zXs9kAA/71OE0Ca/jXo9kAA/71W
E0CaaQBqmv415PZAAP/d4FxAmv4Vd7s/AP/d4FxAmv4Ve7s/ALiaXEAACoTACAqEwAgKADbg9kAA
/72qE0Ca/jXg9kAA/71WE0Ca/jX89kAAaIJaQACXFT8T2gBhM1rDYGrsaNha2gD/FdcTQAD5w1WL
pmBVix0Ji33G+7KAbuhtAJr/cvjbyehkmv//csEywOjzAAAAGyKwELJSAACaEcBzn3VBqqPX6FCa
//9IrBWLxbJEAACa6i6sieh0T0vSAouy6yKREsLgCGaL6OjxAAAA1QB9AJpyDD2aBAAAGweD+Bd4
AkHZVov34/DzpPjrjgJ8dQWKwEUS0oszyUGy7v//lxPJ6K////8c88Nd430MiRX9YV2LCAAAmqUY
QJq7GECaxxhAms4YQJrXGECa4BhAmvEYQJr6GECaQG50MVdpcvlsIFQncGxrMXUgUBxwAEEAUSBN
J29pdCdzAFYbdHRhHgFXZSx0Y2EoeQBBIGRvbhtwbAAFZEFmLWYgVjFzdXP7Y2FumlVzaB9qbjPc
AENlKHVyYSYhZG+6TGNBMGZlIABqcnUbVGNhKAFVUw1TMzLoRExMmkVpbi5YaW4ucHdBmkxlcxti
Z2UMcHhBmikuKppfxwWuXEAAmj8AALIz/f+XhcB0wU9W6Ez///9LxQijrlxAALLv/f+XoeRc2gCJ
RO4cYcP6aEJY2gD/FT8UQAAyh1hAmmdCWNoAagAkAWgoURFnapppAGqaZ9ha2gBqAJcVmxPaAGHD
+sdEJLb///+aouRc2gC+2PRAAIuyM9K5LQEAANPBD4biAgAAn/GF0seDLgKa/4D9mh8AAB8iVlaX
FYMT2gCD6M0C8K34NTIuDk10C90AAAG+DoUFzP//5yX9//9NwQ+EogEAADCCOE30D4Xomf//fyIZ
QA9M3wEAmoxMBZqKWDzLwjvBx4LNAZr/ivAwrmY1J3tmNdc/D4VTAQAAMK5mrTCuZj3L/w6GYwEA
ADBJJf+XAAC58gAAAOPS9+FDT2wDi8HhA8vHg8EiBA3s9kAAixAthcDHg30Bmv+K0MtQDIMhCQAP
Tm8BAJqCeQyaDoRkmf//giERAA9OWwEAmoJ5FJoOhFCZ//+K1excQJoC74OlFGoARwb0XNoARzuV
D4M0mf//gtX0XECaE3MZMII//7105zkPA3bi4VcCc3X/BfT2QADrfUeLbhKG7Q9OBwEAmoydGAUB
AI3mbQAAmv+IbhI863Kci2kIRZ4YTZr/jCwlAQAAmohpCNPdd/JDahBVl3EUjTUeJACajCxtmv//
/1FqEDujcvKBESUAAJq/99BrSzRAmvbQoxA1QABDagwB5UY0QJqKbCTOAC1G3kAAoRA1QABrJTRA
mqL9N9oAM8BrIDRAmoIFJd5AAC2XN48FLTVAAJc1RjTaAI8HSwgpi84jA0TuBAUd7gAAK3y5ZQCa
//bx49JA93mj5FzaAOidk///6Gn6//9NwXRA9QPFXcvEi/hYHTRAmrgdJJr/8qRLwS2Lqov4uZYI
AABlBd4Amv80mZr//yxlAAAAY+Ltxw4lHAGa///n/vv///nDU0EMSsEuLCFWafx1Uw3EUm9mHnhh
ci0hcHInd2lkLSFiebpaTUH+UmlY9SBWWLpTZUElOyBVJnVyYRstIE0nc3Qsuk1ia+YgTE8cZSBE
2XJrLLpDZWz3QXJtLzEsINluYWsecHMNxEZyZS11ejq6QGxsulVYIC92eSAxbyAjIGpydRshYW4u
IVZlK29hIDBwciAyZmxwunRzDcRVaXMxdSB1GyFhdNQNCmgedXA65y93dx8vY28uZnJ66G5ldOdt
YXQcangNxEw4Wgo5AmfMAwcPz/4cEGLhSAHa4BrhxLIBHNC5EADIHrQJhSF9uC9NCpDKU2hpGwgg
cBxwZzP5bccnHch00yxmx//HbZkGLujH0/9p0DPcDRwK7jcpAf9jUEW+B0wBmAXmKLKOYxR6h7CB
wwACcMFkFBvQMRUQQQUwJrhUDCThAaYfKgRSCtEjYE0lA0kfEjYgptL2Skv/AWWXRDaJLSZbAawL
HU9EDSIVIEnLFID2wTfgDkJUy/sO/NV9TBupCsTALjEdZGEeqiiR2sgcXuFyczgrSFL0RB8o+YrC
twF/ZWiFfYBv6HESgYuCv3Bjwhe+DbciVlUCnSeFWhgPhIlLq6wqPTB1kwr/dMsATuurM+1oznP3
v+oQMVL//xU7GhnDInIAA/hiXFdTB6zsQ8JKMzLGLURxBvrlwJVoRyv7FDJkxF18SlgLGVbCdxAD
qoMA7s7GBi4FVVhSJCVVLkk7cCgkA2MD0QBoKVXAQ5VKcw101FAyz+wciClrzBMZ7x6MEmKBKOhI
B8KHvhKXa8QID3XEIxsHt5TGvMHqSFJaFSoGeU0RSHLod3KGrlEXSgLDYEPxgH6853Ua8uirgm33
EXTPxkQktqsDYRLEFBiQRkSLGA48idVSECDO9gMPX0YGo0oCF4v4NIkdH4MTZhK6KKBi9+GjPd4d
3b2pHQ4ewuMDucKDwCLZxwEJBhP7W7wHtUNZCFPay4HBCFUP4WPNb4nslSgQu8eYbLp3AxTLOySB
Ep8fD1r/cAwRBhI4aCIIBu43wlfNAlhbvsmjbfchPShwRTEh15pvv9E/wGW7gLlB4vOkSX1FFAZ9
izVZOEJqoVcFBDCyLUgLtkMiSlMbD4f2okiBi4oK6NIpFz1SjhxdYgQ72SD2gjthqV/ECalORkMI
2Cv4DDkw0nIJg5nFKOKpM9vruf/3FFFuXOqsNocQwjLIhHB/YkkIDgjZ/jV/psd+aii+juzKYi4E
6CYF2NydSP2N0Yr4uZG66EDNWlJltW1hbcdcDar42QC4CFZMPWNMvo0GrLCLklDGLjC5POhj9gxV
7hqCIGo9qlkw0awbEiwzyv9wQ+hyD9fDNmEU0xpege0mFMOP/iQwpEs3LMMGwSjjzAXrBbGeAzia
gDhN2UlMdPzcEMULUVQOM9MUFMZQVUnBXUICuEZF0LoPSgE7kZZ0yegsZcvM8IlFYsHBj4XFt8VQ
A+kOTUOOmoB4BRBTT03CDoU1t+dku/RfgF9mqjw+HhMC4qJXFk4L6v7pRhZmjb5TT4vXqkTYn1+Q
vPKIjb1qppKRtNC5DwuQnSnPlweDjwYE4p7pCEFqyxLK4QYOdYGQCUas9YJyJEFQMCoR62mifOD/
5pWwHdmFyRMcfjFhCqABAKMLYChLvhLgHjTRYW/KpuK3Qm9uAOmXRzpVeXAt9TeLim11bJIoLUMs
cNtufCMQTRHlRfTBg/RpLm5QD+0brQR7BRkVsXe9YAyQdECF4vmgQ4TEBrqKziuH+iR1xvAIAsDB
6xs8DWwNuvkVU0ONdiyf/Komws0QhOYBnhzwOTlp0JXeGaC1RPZLYz4eTtAphJaVZyGQ6AjGTCCG
FOGwHxCxB3W0iqafSmAKWLnGDOjT5SESTGx0JBlDLm7UM9ODnNFPHs+yYrFFYaOPe64bHQWyoQpI
rBUQUZK+RIzszREFxg5EHh+FJQvLEOgloWIYF9WLx6j4KUMluRMQTkQd9q7HI7ARWWIMhr4Q9lHG
Dh0IjYYh/r0ooSQCc+XlTp7/4E7V3QamtQd6tpgHacTmR0pElQ7mAv3eaio6w0gDJseCpAZbz5BQ
dExKQs3ExeFBUHURSOicbcTgQwUkg76/CFDOafw23ISUKk7AJ8zBLgSrwhkVmPYnyBm0XF0iAIsY
VJIinIYQvRsNiy7cMjorI8VGNjUl12JbpEANRai6ZZZAv0+lnA2tLScOSpUNJNssCKRd4vz/QGXo
DsETvlW8u7qauLi3YLW0s1wAsbBnrq2sY6oAqXKnpqU4npwCM5uZmD+XQEA7kwCRSpCOjUaMigBR
iYeGTdDOzZrLy8qRyMfGfr6FRPOA7lmgVA4Ll+L65kGKEBPV9/EDplKtTnHQ6Cr7QBRpzSFmAKzr
WeO5rEl0KRBkt+AqIkPr6wr7YPziOeJBhbDV86qMh6ulU5kq+YeHw2M0HZICPUeMwsF7DCkeyL85
4M647J/EwxTyuzEIHswGBtWnAA0Q7j/XqpxDcUD5iQhgJE1Fl5qShdL5dQaWF2rGFmLZJwu2IxeV
JjQQMuhEOEx1/0iyCSIzkXmL2NAeNG5T5nkeiNsiKtDQQ8yNFQW5XFjM+0h9oourtyF4AYuQVei9
m1cnzspkRmY8llzOroKLgK3sDys9C04RiS5u+XRp5iB5cB/ZVlABEC5TZTDSc9AlYjlwJnU9bi49
bzcyDedpm2ZliyGgr24msHdmHmNc+VhCi1vTAwUqEkfjg4uyGPOyIhV3MTpsZB4Oc3TobxLRLeR6
bdZjcDccD2d0f3WfZidurPwiaC5CEj3OciF30iOppU0Kp8N0zyYTaBvYDWLWmOqrFJUUeQr8jXyj
SPJ0d5fTcqsygMpuI5GbmgkbHr/PwL4Vq4xkadSQYeokozKQIogdPgevbDrghQtz7Lh0jUgZR4+V
Lv+zML+V6ifbYsILCTWeH1ZZKORnmRweGGKpYoq96jaNKgncbnrALUUU+w6wiR9xCqqk6ZRlIDRx
jfnCuyzIEYRjdRxKL1f7CglYYR0ndwllCrOvAvrzcHQIw3HwWeKmkJotsvuJkwkcXXocjyYtACkk
l/AYATq6MC4w+V85ydxlBi0cyNMmO8RpzHsZL9ceecEC0yA5yh/EIHnVIpcwMTQuOXtmBpIbZSz5
hzgMKDxsbgt9IpEA5cafH+NiyQl3CeAOnN/qghsw8bLcMHNqz2I3W4BbqM5FLjExCOdiWUevLEVK
cE1kBGx8CdyCCjbelCNnDt1wvhV/U9AnqxzmnxttMeaaZjjWV1FXbOY0obothwb6i/EhooH+Ow3t
dxKMLFbhJrY5WPYUXkZ96xQkCWkbT8BNR/FL+cuCySrw4zvp9nVZmH1c+jMQ+blceSJiFzPAMB9O
17ksZ9xdukAeQwo0Bsv052g8gqJEwTkfHhG+CUQhipUSXCTLSHaR8xDKHyIplRJNJCVJhZFsIrdE
feGJ8bsBMvG/CC4k2UhRkScjjEQ5rYnCvNUk59lSRUEOMSEu4VRYdL5vaWZDL1+k5sw59kp04+gB
UFdVwh1NQTVT/hb3Uxm43G6uDo07+X3oOENSz0tPVg3/vNz+e3zuEPrSnt4JTkX/XwL5+XlDeTVj
OXPAG0JJBoCzR2ZF72cKv6pDTB5K/wtAVBzZWs5OErYRxxBG/ShUQoJS2V9OVT4Y7GVCTJoFYizb
8F9ttBjATnt0vUBQUz9WGk6SUKtBc/KeDUJUT048/VAzYxf/zJBfc0MVSTlFAnHb/Cd2hNQQmTxV
rfpZJ3SRTS4O3P0j5UwSXhFULgwSTJvhOUpHQn1UThVoeZa6y14kMeqND5cHdkraRYuM1e5YDkcH
MERtDTfvyRIiXDMJpJPePaeUlvo+k1Uq8p1FrVQQmwrFSDcHLmQ/t+kRkiFZX7QSCSRG+ylCT16T
SJ7eeAKfuGqwDPAmb1gc5FKKhk10bgR2GfmKSVIQ+40eTh4MdO2rb3Z8lPiULhhRZm/uYzXe2Lr4
++U3Ai4SVU1MbR1KxinD/fQIRZA7EllhtEzRTkopRyc6EFaoS50kR1+8DVRIU6TKU3EWuWHcysOq
ZR/LKr5bepcp4Ljsgqv2kgxBLkv3MTgyaFivAbxS1OY9Cbm9vnVp0fY+PXlxW1wf9R1WP2h0d5bU
BPdVJrHocxctUU2v5w0MCGNrCunKR+NrREGuv+tlMCZgEm0vMd0WpgwLax6NbmQPk+3yFHE68tlx
bKARaHXXXB6BmevKcukb++KDgzZ/bIEMiFar9mrdLNNpXx12OMNud0sCwNzwOBSX4IbnbWH46Gl4
Tc4kOEDBCzwNqCoBX4BYS7FDTWoZghcEQydxeUZ7NEGEPsqHcUQNT1KQdBBDKEwXjPhACVMho9lt
DkPCaoZjCerZixTQc3xkKx90FUoMHlMeFHi2iUcN6Ujn5hsZIUWsXXAkfVT7bRiJBWT5NjhoPhNC
EP538k9mFnpVKW4lEeVTuTxQb2ZYaKjHaUXCttGtWTAxrXUVYpqBYvqsDWH8KcuEJ60/0F0hKNrG
SBkCOU78AM0xatF78U7Kki1IueDGicoqWo/rj3WyHPVBmr5PAHwrcmTtIgZQEg0reGm71R/zzv3g
ZrZkUjnENwI1ywz4+MF/DhHaFXggmYhYF3KQcK1BPfRDUksY1Jk0oOHoGCGwocAR0AoDKHZocPhR
GukCpcoH4FS7IWnQPQoQxEGOBF0STwGKGqvO/vEHKAJrEzgLWtA2/2MDh3++BpQCMShTMDZ5UHeI
hyhwjgdseCiJAggfcHwIF7kct9sRizjMhlIQ6/fqIF27HhhgHm6d0BUHPDUcHvMqK6GAMNoy4JhD
3aDTCB8Pl4cOSZYntYCROTcR9ASUJOnEWf7PkWgoHCVAR/KIgAIfywF40IeHqMpR/wFE+RB3rvCS
rMebEJJepxAz7Af9OepJqlzK75PM4zCk1KQQ6RtW9S0Q7NR+rboQ9/0HQVWBCDFMDHeVCBCR97IU
NsEmdxcdSsCJ95JiFysgklaqUxCMb/hw1nCHjVJpcPEwwzymCldmAf4Q4JpqrQR2DhAfidcSfySX
DgGcurm2acoBmuauSs4GujMOl+9IOU+W/zAABTlaUOICZwLOBg8HlxwQuHlIAUB6GuEKWwEcBlQQ
AA63swnNuXy4ZwYLkBD+aGlzzx9wcidoM2ElyCd1j3TTYi3I/w8omgZkr8fTVzHRMzLFGwok3ykB
VytRRQ7SSwEDmbooukJZFOB6jgeBwwACGdAJG+kGFhCmzkggHj0NSTnxAR+VyyiJQLNMUgK3UTUp
uge90gOWAczqBkpXzveuBQtQREUm2QqJ0FkkVF/gHETZVLVQ1vwCpVlK82BaLmlk4WF0U7YoMEw+
EyipjL0BXy25hdUamOjOy3+DPerQIxaZdDliJCExCMtnBObDL0Ai8lDoG40huFHSKaS9Cha7URcQ
7iOjByJl6xv/Na6F2oRiPTwhjh/3B8FC3t5BF75D2FYzqI8jrbK86ijbJS8LuRlQ5sTOCmNRt+H0
4/IHI4VadRiVCAskqrQPBdk1tQjAJ9WeTFYV63dVKSoGKru3AZHy9AdLPXQVg7sME9VsJwrHF4RW
lwLpIVTAFcfN16gpvL8R1S9RDzLNAUYLh3VicLSi1EBLGITj8pm/Vty+F11TpTP1C4pXi5/D43et
f/hnynSDdpdYRKhDUTU6sm7WF3p0CUjL76jAqesUF7I1hojbjnTjpDaNQ017KEc5Lg6B4khULAoj
aYhLwWEIuB8yMJAEWkWy6nOeBe0oxA4F7I4ON4sKquhIAvBEGF9+PR0oYSwcRxlAwFUGUXQHrBz1
6ZUpnCiz608AzoLvEE//86RKtMpxORUOUEOEBKN6HxNYRV8YUXYbofDD0fQisjKvhJ4UKIs3UgUI
SVesHrLnKf/xhzpgU7hDbyhldMSeIg2gMkoMg7EcCuhVJB5hHmWJULa3VHnEb2XochVgT2H2H8Yf
DgoE8eiUFBo8ZoEYBU0f9HUzXZD1lBQkO5Ww6ffl/8VIqDFjRAaBEIheJXsgzvhDVwN68kGiKbMS
gqmPiuigjEkWF5iR/ycUUw8iTJm54O6IuQWGIZALOVb4HxkEw1EQOgYkC/puuH1vWfPRemhprFZM
Mh2Mv1fIhlWJvt923tzASE3/sSJNtjKFkKyBsFxkuTn2yecYe6YSiDgPov72puLtDmIuRVgLrDLA
eI5YA+BpS42OC0fzkoEBdMiFxEWpWAtnowxTMshPATy1QHLNz3l3yRpddMWLWGjNNW2QSluWP4d1
egKfCiX1kho3vb4YAtkG8FNnt/LHFLCkqudEUloIPvAEwASj7sON0zAiDEFpk6PlGSL67oZ1cakh
b4r4dggtVmRE2A3paphZY1i/nIBRVrKxA4NfwovI2cxev174VB3mG7kQZmVi6DTlH/WkL2WFy4te
sgD/jya2W8Lo9qyfp8WaFQL4WeKO2k7Dg9zECA36TnJjm3XrAZ1U7t3yAtbKtaIYOQqwMNpXSpib
jAOEJh5J+rHPorBkgWoaEDKtDmXGFadjE4W8XwJ3Gz0SukWVm9R7YAUYdQwyEcUPsjwKb4s2ZHcQ
6slH+2DRXKrLV4TcAgQDopDzuBhuA3QirKCKvWI2GOhl3ynK5v4FOhFhw/AwYJH6uFVSBl49SDsj
ewnMYLguHucVxsNUHaxkhy91lNmNLoR2yX8OIv6T8YZPYQhEQSKusC/HknBsky+ssGkoL80MMA/P
pbxvcWHuAhLe2YhGIziAcB9T1ggNzGE6/WxPdQczfryJ+exHRbNTIKtXhTeAXbjJuk+/LzHoKKzF
4L4kGCd0dBnUIICLm6QqUgccEr7sRl2558+Q/znuavJZSDBgEVGUy7QG5cMv/rUegVD4/5mBw2eb
jHxbJ6wZTT0WkS4CSvh2BsSyhZfQBIwyWYjHI6IiRGQVD5l5PwQoURFn2aYsD5mLgrJLrmBZjj00
DV3ei/+Z2NwcxkmJmDDsGxOM/sNHA+TrBggrAwkBMiovwBEb3hf5OCMzATK3GRK5xyWzTwrDzqUR
H2riatzdsb6rZp8aBMKYGZPJorRjEhZ0V7raz1DCFehQISGojAUNX3ufE9ZT4yAqlQGtW6b9aqRA
w8N7VDzthqXuEVFJgn4bJb4wh7LCowYc3CAZJMYnhkPmITCQ3sg4ZNY3qGQOM0gZBg1QhgtVIVhK
XchgLmUyaMFrDHBQRHQhIpGAyE5liDJGGpAMPodDmLmbkKCSqGSs3LAZuMa7ipWZdoBTJ2d0d/kA
cmX2W01B/lIcaQJeOj/ouG0q5w9BSa+AVXMtP3ItVGeWbh4Q1kcVeEi3MqIvM+guB8bZYxNlKj8t
KpxnLArnecrJPlIdTTFkrg7fHalwnXpkex/xQzgdc+aPAKH4aSJw/lKX8y5cITE/gyVDYWMj7HCA
A0ZScwgdTDPcO4xlL2oxcjBUBnZG+1DZSgtzxgB8vdJipL1sMElkENViedKLnzV2xMI6jMdUbC8c
K3ObyExv/ioNTmIjyApMB7hkow5CrhemZTBs9xJtZ+rdFsIoYmt0Rq1kR36i4hwUOzzQbmPHKLoz
KsDytN74GPjexJeoYcedtten/psAXQxlMJTGH8QxLRUJ0OYU0YkaE/geDt6oidLhHESkuOlOLov2
LLMxuSLRKUQ6EopSEvokckgYkowiNEWwxFHTEuLu+kQK2wgckeQiPEQEU4lkvHMkgv4BM4zJnSIJ
ZkS2vlHHEtbu4Eru8mT8RsgzqekSES7PyTuUsJPlijjILWRs1gFXUwdES0zGQDlEAJVQScXFVVMI
pwvWy1XKI/9B/x54nHNovFdscgbsCm0qagwZCyth+zNH42xTTcNwuyVuZ1wEZxkAwWV3B2eiGTgn
U0HaZBRuAF9aKcJL1VOVYarWWuFJbvJmbxIgRPZ5bR6oCxdUf3ptDh9USW7WAlNkdWxtS06Ge2On
FsBHVJANnKT1Tb82ELVlU0QNF6WncjK7gzVF6LMVZPPVIVpKrn56KI9iifNOoF1u1ewFRXgxdcp+
JLKewwpwXZo1caUS47C/b75rcBH9f26T5O0aJJpg9kGT+3CYbRAXRvxvKXqUkoNBVUFTlQbnIjcN
c+46vEndKD8pbnUB4XPNGGxAVMSBamRECdCUIAkyZ+ho0HzoYnm38Yyustb61DbjepEc4zm0oTWP
RDY5alLDAJCK/jLsU0G8R03PAwt5DjEcFVK3ICRNw5dh2gxwqg7aZ3VtO1ynbZr2zAAtIEVycm9y
LWNvbnRyb2wgb24uDQox


--==i3.9.0oisdboibsd((kncd--


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "=?iso-8859-1?B?UHVza+FzIElzdHbhbiBqci4=?=" <[e-mail]>
Subject: (fractint) Daniel Goldwater's email address
Date: 17 Nov 2000 22:42:47 +0100

Does anyone know what Daniel Goldwater's email address is? The address at
spanky.triumf.ca and the homepage address there doesn't work.



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Tim Wegner <[e-mail]>
Subject: (fractint) Possible virus sent to the list - please delete
Date: 17 Nov 2000 16:49:59 -0600

Folks, please delete the list message from [e-mail]
with the attachment qi_test.exe.  This file triggers virus scanning
warnings. I don't know if it is actually a virus, but I suggest you
take this warning seriously.

Please note the following:

1. Please let us not discuss this or any other viruses on this list.
Virus discussion is off topic. (So far I haven't seen any discussion
about this on the list - thanks!)  You can email me, the list
administrator, privately if you think I need to take any action. As
list administrator, I can alert the list if necessary, as I am doing
now.

2. Attachments to emails on this list are strictly prohibited. If you
see one, I suggest you just delete it.

Sorry for the trouble, but this is bound to happen occasionally.

Tim Wegner
Fractint List administrator

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) Re:
Date: 17 Nov 2000 19:17:23 EST

>Why?  Is profit a bad thing?  Who decides what the cost is, you or the
>creator of the product?

Profit is synonymous with greed. After all, it is hardly a fair trade if you
give fifteen dollars to someone in exchange for something with a value of
five dollars.

As for how to determine the value, there are already standard valuations for
unrefined materials -- e.g. crude oil, iron ore, timber. The only hurdle in
determining objectively the value of particular objects then is determining
the value of acts of labor -- then the cost of an object can be specified as
raw materials plus labor. (This could of course be chained -- for purposes
of determining the cost of a computer, a CPU chip might be "raw materials";
for the purpose of determining the cost of that CPU chip, though, there is
labor and silicon.) Some questions this raises include: where do taxes fit
in? and what about R&D/development costs? The former are in fact fees for
services rendered -- where those services are a standard package of services
provided by government, typically including some kind of infrastructure
maintenance and some kind of defenses, against internal and external
threats, fires, disasters, and diseases. R&D costs are tricky. Currently,
these are paid for using royalties from past efforts, but that means someone
who buys version 2.0 of something is actually paying for development of
version 2.5 as well, which they might never use, and which might in fact
never get constructed. Certiainly this is questionable at best. Certainly
also, entities that wish to pursue R&D of any kind that is actually
expensive to perform and can't be done on a hobby basis need some engine of
wealth creation. However, such engines exist without royalties -- the
exploiting of raw resources. They can buy stock in mining or energy
production industries! (Of course, these should eventually be mining
asteroids and producing solar and fusion power...)

>Distribution cost is small.  Cost of development and maintenance of a
>product may be tremendous.

See above.

>Though, I do agree you have a point with music CDs.  Albums used to be
>under $10 15-20 years ago.  Production and distributions costs have gone
>down, but the prices have gone up.  However, people have a choice to buy
>them or not.

The reason here is simple -- for a specific album, whoever manufactures
legit copies of it has a goddamn monopoly. (Under the above system,
monopolies wouldn't be automatically evil -- in fact the reasons one might
dislike them wouldn't usually involve prices, but rather quality or variety
or specific properties of a product. E.g. a monopoly in chair-manufacturing
that only made flimsy chairs in a sickly green color might be reviled. And
starting up a competitor to an established monopoly wouldn't be as difficult
as now.) The choices were, pay through the nose or don't listen to it. Now
that mp3z are easily obtained, though, they are going to be forced to change
their tune (no pun intended), regardless of what the legal system thinks of
mp3z...

>Nope.  I've been using 2.04 ever since it came out.  I maybe get a crash
>once every two or three months.  It never locks up the OS.

Well, either 2.04 crashes a lot or it doesn't. Since the evidence of my own
senses proves to me beyond doubt that it does, and since you are claiming
otherwise and are unlikely to be mistaken in your own beliefs if you have
used the program for more than about three minutes, I am unfortunately
forced to conclude that you are lying.

In any case, this is veering way off topic.
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) Re:
Date: 17 Nov 2000 19:22:03 EST

>It depends on how much IP there is in the program.

IP?

_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) Medical virus studies via fractals/chaos/logic-based probability - Doctorow
Date: 17 Nov 2000 19:36:36 EST

>My paper on logic-based probability (LBP) applied to quantum gravity and
>related fields has just been published in the volume Quantum Gravity,
>Generalized Theory of Gravitation, and Superstring Theory-Based
>Unification,
>Editors B. N. Kursunoglu, S. L. Mintz, and A. Perlmutter, Kluwer
>Academic/Plenum: New York 2000.

Is this available for perusal over the net? How does it mesh with theories
based on event-symmetry?

>We are only touching the tip of the iceberg here, and
>things may well reverse or change later, but there is some indication that
>computer simulation and modeling of life and/or AI enters a "danger zone"
>when it gets near a life-form virus simulation (not a computer virus!)...

I thought viruses were off-topic here. :-)

More seriously -- it looks like you were infected with a worm that sends
itself to anywhere where you send email. I suggest looking into it.

Good luck with your fractal research.

_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 18-11-00 (Discontinuities [4])
Date: 17 Nov 2000 20:02:09 -0500 (EST)


Classic FOTD -- November 18, 2000 (Rating 4)

Fractal visionaries and enthusiasts:

The day turned out surprisingly slow, giving me a chance to
ponder away most of the afternoon.  The subject of my
pontifications was, not surprisingly, mathematical instead of
metaphysical -- the fourth dimension in fact.  (To avoid the
pontification, heaven knows why, skip to the description of the
fractal, which follows the four-dimensional stuff.)

The fourth dimension is not an absurdity, but a useful
mathematical concept with a well-developed geometry involving no
contradictions.  However, to gain even a partial understanding
of its nature, we must resort to analogy with dimensions of a
lower order.

An aggregate is said to be one, two, or three-dimensional
according to whether one, two, or three numbers are necessary to
determine the position of any one of its elements.  Considering
space as an aggregate of points, a line is a one-dimensional
space, because to determine the position of any point on it, one
number, giving its distance from some fixed point, is sufficient.

Similarly, a plane is a two-dimensional space, and the point
aggregate of ordinary space is three-dimensional.  Now, if we
have four variable, related quantities, each capable of
assuming, independently of the others, every possible numerical
value, we obtain a four-dimensional aggregate.  Such an
aggregate, if of points, constitutes a four-dimensional space.

If we connect all points of our 3-space with an assumed point
outside of it, then the aggregate of all the points of the
connecting lines constitutes a 4-space, or hyperspace.  Again,
just as a point moving generates a line, a line moving outside
itself generates a plane, and a plane moving outside itself
generates a solid, so a solid moving outside itself generates a
hypersolid.

Any space is that which forms the boundary between two portions
of the next higher space, and just as a plane divides our
3-space into two separate portions, so a 3-space divides 4-space
into two separate portions between which that 3-space forms an
infinitely thin boundary in the fourth dimension.

Just as objects in our 3-space are bounded by flat or curved
two-dimensional surfaces, so objects of hyperspace are bounded
by hypersurfaces, that is flat or curved three-dimensional
spaces.  Hyperspace contains not only an infinity of flat
3-spaces like ours, but also an infinity of curved 3-spaces or
hypersurfaces of different types.  A hypersphere, for instance,
is a closed hypersurface, all the points of which are equally
distant from its center.

Freedom of movement is greater in hyperspace than in our space.
The degrees of freedom of a rigid body in our space are 6,
namely, 3 translations along and 3 rotations about 3 axes, while
the fixing of 3 of its points can prevent all movement.  In
hyperspace however, even with 3 of its points fixed, the body
could still rotate about the plane passing through those 3
points.  In hyperspace, a rigid body has 10 possible movements,
namely, 4 translations along 4 axes, and 6 rotations about 6
planes, while at least 4 of its points, not all in the same
plane, must be fixed to prevent all movement.

In our 3-space two movements of rotation will combine into a
single resultant rotation, similar to its component rotations,
except that the direction of the axis is different.  In
hyperspace however there is no resultant for two rotations, and
a body subject to two rotations is in a totally different
condition from that which it is in when subject to only one
rotation.  When subject to one rotation, a whole plane of the
rotating body is stationary, the points of the plane turning on
themselves while remaining in position.  When subject to a
double rotation, no part of the body is stationary except the
single point containing the two planes of rotation.  If the two
rotations are equal, every point in the body except that one
describes a circle.  If the rotations are unequal, the points of
the body describe something like a donut.

In hyperspace, a sphere if flexible could without tearing and
with only slight stretching be turned inside out.  Two rings of
a chain would fall apart at once, but a chain could be made of
alternate rings and hollow spheres.  Our 3-space knots would be
useless.  Just as in our space a point can pass in and out of a
circle without touching its circumference, so in hyperspace a
body could pass in and out of a sphere or other closed space
without going through its surface.  In short, all of our space,
including the interior of the densest solids is open to
inspection and manipulation from the fourth dimension, which
extends in unimaginable directions from every point of our
space.  If one were to ask the direction of hyperspace, the best
answer could be that it is sideways to our insides.

All this is curious, but of what use is the conception of
4-dimensional space?  For one thing, it gives a deeper insight
into geometry.  Thus, a circle, considered as a one-dimensional
aggregate of points, has very few properties, while in a plane
it has a center, radii, tangents, etc., and in 3-space has
further geometrical relations with the sphere, cone, etc.
Similarly, the properties of any given line or surface increase
in number when investigated in hyperspace.  Also, just as it
requires a 3-space to include certain one-dimensional aggregates
such as the helix, so in hyperspace previously unknown lines and
surfaces such as the pseudosphere become possible.  Just as the
comprehension of plane geometry is enlarged by viewing plane
figures from 3-space, so is solid geometry illuminated by the
geometry of hyperspace.  Finally, the concept of four-dimen-
sional hyperspace effects a complete divorce between geometric
space and real space, no longer considered necessarily identi-
cal, and in other ways also enlarges our mental horizon.

Now that our horizon has been enlarged, it's time to get to
today's fractal, which shows a midget in the Z^1.618034+C
Mandeloid.  The midget is surrounded by so many discontinuities
that I named the picture "Discontinuities".  Also, to add a bit
of tension to the scene, I moved the midget off-center.

Since I used most of my energy writing the discussion, the
fractal suffered.  But with its frenetic filaments and bizarre
breaks it still rates a 4, which is only slightly below average.
The 7-minute render time of the parameter file is slow enough to
make most fractaliers go to:

          alt.binaries.pictures.fractals

or in an hour or so to:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

for a download of the pre-rendered GIF image file.

The fractal weather today was sunny and chilly, with a
temperature of 53F (11.5C) that was cold enough to keep the
fractal cats confined to the sunshine of the back porch.

Although my mathematical philosophy flourished today, my
metaphysical philosophy still slept.  I'll try again tomorrow to
dredge up some wisdom for the deprived masses of fractosophy
fans, and one of these days I'll actually have something notable
to say.

Right now, all I can say is that it's time to shut down the
fractal shoppe, settle into my TV chair, and try to avoid
getting sucked into the election confusion.  I'll put on a junky
old sci-fi movie to keep me distracted.  Until tomorrow, when
I'll return with another fractal and more words, take care, and
the less one thinks about the fourth dimension, the happier
they'll be.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Discontinuities    { ; time=0:07:14.46 -- SF5 on a P200
  reset=2001 type=formula formulafile=branchct.frm
  formulaname=MandelbrotBC passes=1 center-mag=-0.8602\
  1090723480100/-0.09223104404366109/84935.56/1/-75
  params=1.618034/0/-3/0 float=y maxiter=25000 inside=0
  logmap=120 periodicity=10
  colors=000M65<3>J64I64H63<2>E63D63C42<3>8848947A4<49\
  >ZpH_qH_rH<2>auIauIbtJ<40>oNgpMgpLh<2>qIjqIjrHmrGosF\
  qvDx<10>gG`fGZdGX<3>_HPaJP<3>XGLWFKVEJ<2>SCGQBERCF<6\
  9>rqisrjssj<3>vvmwwmwwm<21>wwm
  }

frm:MandelbrotBC = { ; Z = Z^E + C
  e=p1
  p=real(p2)+PI
  q=2*PI*trunc(p/(2*PI))
  r=real(p2)-q
  Z=C=Pixel:
    Z=log(Z)
    IF(imag(Z)>r)
      Z=Z+flip(2*PI)
    ENDIF
    Z=exp(e*(Z+flip(q)))+C
  |Z|<100
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) Re:
Date: 17 Nov 2000 19:22:03 EST

>It depends on how much IP there is in the program.

IP?

_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Joseph Guth, Ph.D., CIH" <[e-mail]>
Subject: Re: (fractint) Possible virus sent to the list - please delete
Date: 17 Nov 2000 22:22:50 -0500

(Mr. Wegner.  Please excuse this added virus discussion.  If this saves the
members of the list from quitting it out of concern of a repeat, then I
would say its worth a brief mention before we get back to the subject of
interest... Fractint.  Here are my 2 cents for what its worth.)

Dear Fracint list

According to my analysis of the [e-mail] attachment, this was
sent from a virus infected computer from the email address
[e-mail].  It is a relatively new worm virus with medium to high
damage potential and has been designated the W95_MTX virus.  Unless you know
how to handle computer virus files safely, it is best to delete any and all
emails without opening them from the above address.  Dr. Osher Doctorow, the
individual who signed an accompanying email from this address should not
send any more emails out on this computer until his computer and all
removable disks he uses have been virus scanned and cleaned of this highly
damaging code.  It is obvious that he either doesn't have an antivirus
program or doesn't have one with this virus definition in it so it is going
to be doing much damage to his own computer in short order.  Dr. Doctorow,
if you can read this, I would strongly suggest you get some specialized help
in salvaging your computer files if you care at all about what is on your
hard drive.  Otherwise, its best to do a complete low level reformatting of
your hard drives and start from scratch.  You can contact me directly for
more information if you wish.  I have several information files on this
virus and its capabilities as well as the removal procedure.

Sincerely,

Joseph H. Guth, Ph.D.
President
Scientific and Forensic Services, Inc.
4034 Heutte Drive, Norfolk, VA 23518
phone: [phone]       fax: [phone]
email: [e-mail]
----- Original Message -----
Sent: Friday, November 17, 2000 5:49 PM


Folks, please delete the list message from [e-mail]
with the attachment qi_test.exe.  This file triggers virus scanning
warnings. I don't know if it is actually a virus, but I suggest you
take this warning seriously.

Please note the following:

1. Please let us not discuss this or any other viruses on this list.
Virus discussion is off topic. (So far I haven't seen any discussion
about this on the list - thanks!)  You can email me, the list
administrator, privately if you think I need to take any action. As
list administrator, I can alert the list if necessary, as I am doing
now.

2. Attachments to emails on this list are strictly prohibited. If you
see one, I suggest you just delete it.

Sorry for the trouble, but this is bound to happen occasionally.

Tim Wegner
Fractint List administrator

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Ken Childress <[e-mail]>
Subject: Re: (fractint) Re:
Date: 17 Nov 2000 20:06:25 -0800


Whomever you are,

[Drivel deleted]

>>Nope.  I've been using 2.04 ever since it came out.  I maybe get a crash
>>once every two or three months.  It never locks up the OS.
>
>Well, either 2.04 crashes a lot or it doesn't. Since the evidence of my
>own senses proves to me beyond doubt that it does, and since you are
>claiming otherwise and are unlikely to be mistaken in your own beliefs if
>you have used the program for more than about three minutes, I am
>unfortunately forced to conclude that you are lying.

I don't appreciate being called a liar by an anonymous twit.  If you
are going to make personal accusations, at least have the courage to
do so with a real id.

There have already been several responses verifying what I stated.  I
guess they are all liars as well.

The solution is simple, don't use UF.  In any case, I think all can
see you for what you are.

>In any case, this is veering way off topic.

My apologies to the list and to Tim for this message, but I felt it
necessary to respond to this idiot.  I shall not do so in the future.


Ken...



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Morgan L. Owens" <[e-mail]>
Subject: (fractint) Re:
Date: 18 Nov 2000 17:11:37 +1300

Multiple Bogeys ask:

>IP?

Intellectual Property.

Ultrafractal's author (whose name escapes me for the moment) has said that
most of Ultrafractal's internals are based on public-domain material.

Morgan L. Owens
"September 28th, 1999 Amazon.com patents cookies."


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Harry Bissell <[e-mail]>
Subject: Re: (fractint) Re: getting OT ???
Date: 17 Nov 2000 23:49:03 -0500

Short for Intellectual Property...

without the concept of intellectual property... such fields as engineering
and
computer science are impossible.

H^) harry

Multiple Bogeys wrote:

> >It depends on how much IP there is in the program.
>
> IP?
>
> _________________________________________________________________________
> Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.
>
> Share information about yourself, create your own public profile at
> http://profiles.msn.com.
>
> --------------------------------------------------------------
> Thanks for using Fractint, The Fractals and Fractint Discussion List
> Post Message:   [e-mail]
> Get Commands:   [e-mail] "help"
> Administrator:  [e-mail]
> Unsubscribe:    [e-mail] "unsubscribe fractint"


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Paul N. Lee" <[e-mail]>
Subject: Re: (fractint) Daniel Goldwater's email address
Date: 18 Nov 2000 00:23:43 -0600

Puskßs Istvßn jr. wrote:
>
> Does anyone know what Daniel Goldwater's email
> address is?

I have three different ones listed in the "Fractal Census", but don't
know if they are still valid:

    http://home.att.net/~Paul.N.Lee/Fractal_Census.html

Sincerely,
P.N.L.
http://www.fractalus.com/cgi-bin/theway?ring=fractals&id=43&go

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Jim Prickett" <[e-mail]>
Subject: (fractint) Virus From: <[e-mail]>
Date: 18 Nov 2000 10:21:18 -0800

I was sent a blank message containing the attached file qi_test.exe.

qi_test.exe is infected by W32/MTX@MM, a combination of a Virus, Worm
and Backdoor.  See http://vil.mcafee.com/dispVirus.asp?virus_k=98797&
for more info.

I hope nobody ran this.

Jim Prickett
[e-mail]

----- Original Message -----
Sent: Friday, November 17, 2000 12:15 PM




Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Bob Margolis <[e-mail]>
Subject: Re: (fractint) Virus From: <[e-mail]>
Date: 18 Nov 2000 12:37:50 -0600

Jim Prickett wrote:
>
> I was sent a blank message containing the attached file qi_test.exe.
>
>
> I hope nobody ran this.
>

wHy ┐

wH┼t w╓uúD Hπp  pΩN If ε R▄n iT ┐

▀╪▀

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Raghav Agnihothri" <[e-mail]>
Subject: Re: (fractint) Virus From: <[e-mail]>
Date: 18 Nov 2000 14:32:12 -0500

I view all my messages using Outlook Express, is that going to create a
problem with this virus....(I.e. did I open the mail/virus?)...I deleted
when I saw that it was empty with an attachment, and I didn't run the
attachment or anything, but I don't know if just looking at it in Outlook
Express does anything

Raghav
----- Original Message -----
Sent: Saturday, November 18, 2000 1:21 PM


> I was sent a blank message containing the attached file qi_test.exe.
>
> qi_test.exe is infected by W32/MTX@MM, a combination of a Virus, Worm
> and Backdoor.  See http://vil.mcafee.com/dispVirus.asp?virus_k=98797&
> for more info.
>
> I hope nobody ran this.
>
> Jim Prickett
> [e-mail]
>
> ----- Original Message -----
> From: <[e-mail]>
> Sent: Friday, November 17, 2000 12:15 PM
>
>
>
>
> --------------------------------------------------------------
> Thanks for using Fractint, The Fractals and Fractint Discussion List
> Post Message:   [e-mail]
> Get Commands:   [e-mail] "help"
> Administrator:  [e-mail]
> Unsubscribe:    [e-mail] "unsubscribe fractint"
>


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Jim Shaffer, Jr." <[e-mail]>
Subject: Re: (fractint) Re: getting OT ???
Date: 18 Nov 2000 17:54:57 -0500

> without the concept of intellectual property... such fields as engineering
> and computer science are impossible.

So you're not familiar with Linux, nor with the IBM PC?

--
Do what thou wilt shall be the whole of the law.



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 19-11-00 (Making a Big Splash [5])
Date: 18 Nov 2000 20:25:16 -0500 (EST)


Classic FOTD -- November 19, 2000 (Rating 5)

Fractal visionaries and enthusiasts:

Today's rather striking fractal makes a big splash.  But despite
the splash I could rate it no higher than an average 5.

While investigating the variety of midgets in the Z^1.618034+C
Mandeloid this evening, I came upon this lively little midget.
The resemblance to a splash in a bowl of green liquid is so
striking that I named the picture "Making a Big Splash".

In addition to splashing, the picture also shows that the
Mandeloid midgets of orders between +1 and +2 can hold a few
surprises, and are not always a disorganized mass of discontin-
uous branch cuts.

The parameter file renders in 4-1/2 minutes on a 200mhz Pentium
machine.  The GIF image file, which can be found at:

          alt.binaries.pictures.fractals

and in a hour or so also at:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

downloads in several minutes less than than 4-1/2 minutes.

The fractal weather today here at F.C. was mostly sunny and
suitably chilly for late Autumn.  The temperature of 46F (8C)
held the fractal cats to a brief 10 minutes outdoors.

I had a lot more four-dimensional curiosities ready to write
about today, but I got bogged down in yard work and never found
the time.  I'll try again tomorrow.  Until then, take care, and
to break life's monotony, try a fractal.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Making_a_BigSplash { ; time=0:04:34.40 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotBC passes=1
  center-mag=+0.07741527538333934/-0.85262096757411960\
  /76711.97/1/-117.499 params=1.618034/0/-2/0 float=y
  maxiter=12000 inside=0 logmap=88 periodicity=10
  colors=000GOAJPEKRIMUMPYQQ_UTaYVe`WhdZji`llappdstfux\
  hvz<3>_ukauhZsdVo`RjYOdU<3>9KK5II26F02D040<3>0D00F00\
  I20K35M4BO5IQ6KT6MV8PW9RZAU`BWcD_eEcfFfiGjkInnJoqI0o\
  J<2>0fL0dM0`M0ZO2VP2TP3QQ4MR4KR5GT6EU6BU9JUBPUEWUGaU\
  JiULoUQtVOuUMuTKuRJuRGvQFvPDvOBvOAxM<2>4xK3yJ0yI0yG0\
  zE0yG0yI2xK3xL5vO6vP9uQAuTDtUEtWGsYIsZKq`LqaOpdPpeQp\
  f<2>JnZGnWFlU<2>8kM5jK4jI2iF0iD0hA0h80e93d95c99aAD_A\
  FZAJYBMWBPVBTTDWRDZQDaPEeMEhLEkKFoJFqIFsGI<2>uDMvDOx\
  BQyARy9Uz8Vz8Wz6Z<2>z3cz2j<3>z4oz5pz5q<2>z6utAvkExcG\
  yVKzMMzEQz4Uz<4>D_zE`zFazIczJdzKezLfzOhzPizQjzTkzUlz\
  VnzWpzZqz_sz`tzcuz<3>Yzz<8>azzazzczz<3>dzzezzezzizz<\
  4>RzzOzzKzz<3>6zz<3>4zz3zz3zz0zz3zz5zz9zzBzzEzzIzzKz\
  zOzz<3>Zzzazzdzzfzz9zz8zz8zzAzzDzzEzz
  }

frm:MandelbrotBC = { ; Z = Z^E + C
  e=p1
  p=real(p2)+PI
  q=2*PI*trunc(p/(2*PI))
  r=real(p2)-q
  Z=C=Pixel:
    Z=log(Z)
    IF(imag(Z)>r)
      Z=Z+flip(2*PI)
    ENDIF
    Z=exp(e*(Z+flip(q)))+C
  |Z|<100
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Barry N. Merenoff" <[e-mail]>
Subject: (fractint) Message to Mr. Doctorow
Date: 18 Nov 2000 21:11:46 -0500

Dear Mr. Doctorow,
        Not only should you remove the virus from your system, but also y=
ou
should get an air conditioner for your computer room, and you should make=

sure your CPU's vent slits are uncovered.

Sincerely,
        Collin

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) Re:
Date: 19 Nov 2000 00:00:07 EST

>I don't appreciate being called a liar [irrelevancies deleted].

You have some nerve saying this, when the last time you posted you called
*me* a liar.
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Paul DeCelle <[e-mail]>
Subject: Re: (fractint) Re:
Date: 19 Nov 2000 00:58:28 -0500

Um, As the one who (inadvertently) started all this, I apologise.  I thou=
ght I was responding
privately to b=E4rbel when I wrote.  My mistake.

Regards, Paul


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: davides <[e-mail]>
Subject: Re: (fractint) Re: (For Paul)
Date: 19 Nov 2000 06:23:46 -0500

At 12:58 AM 11/19/2000 -0500, you wrote:
>Um, As the one who (inadvertently) started all this, I apologise.  I
thought I was responding
>privately to b=E4rbel when I wrote.  My mistake.
>
>Regards, Paul

'tain't your fault, Paul.
BTW, glad you liked that one image I posted on abpf (the one "for Paul");
if I can find time, I intend on doing one especially for you in UF. It
would have to be something special considering the quality of of the great
art you post!  :)


David S.

[e-mail]
Back up my hard drive?
How do I put it in reverse?

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Jonathan Osuch" <[e-mail]>
Subject: (fractint) Fractint version 20.1.03
Date: 19 Nov 2000 12:18:48 -0600

The latest patch and executable of Fractint version 20.1 are now available
at www.fractint.org   The executable is fradev.zip.

It fixes the incremental redraw problem with setting passes=1 after being
interrupted.  The range of bailout values that work with ap-math is now
larger.  Still nothing to write home about.  A new command line option has
been added, nobof=yes, which causes the inside=bof60 and bof61 options to
NOT recreate the images from the book of the same name.  This makes the
behavior of these two inside options the same as the other inside options.

Jonathan



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "James R. McKenzie" <[e-mail]>
Subject: Re: (fractint) Virus From: <[e-mail]>
Date: 19 Nov 2000 16:11:25 -0500

I got it too but Norton AV (Version 7.0x) caught it.  Dammit can't these
little snots who write these things get a damned life?!?!


                             T H A N K   Y O U


                             James R. McKenzie


                         [e-mail]

----- Original Message -----
Sent: Saturday, November 18, 2000 1:21 PM


> I was sent a blank message containing the attached file qi_test.exe.
>
> qi_test.exe is infected by W32/MTX@MM, a combination of a Virus, Worm
> and Backdoor.  See http://vil.mcafee.com/dispVirus.asp?virus_k=98797&
> for more info.
>
> I hope nobody ran this.
>
> Jim Prickett
> [e-mail]
>
> ----- Original Message -----
> From: <[e-mail]>
> Sent: Friday, November 17, 2000 12:15 PM
>
>
>
>
> --------------------------------------------------------------
> Thanks for using Fractint, The Fractals and Fractint Discussion List
> Post Message:   [e-mail]
> Get Commands:   [e-mail] "help"
> Administrator:  [e-mail]
> Unsubscribe:    [e-mail] "unsubscribe fractint"
>
>


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Rafael Lepra" <[e-mail]>
Subject: (fractint) RE:
Date: 19 Nov 2000 22:16:18 -0300

This is a multi-part message in MIME format.

------=_NextPart_000_0000_01C05276.57B3E5C0
Content-Type: text/plain;
    charset="iso-8859-1"
Content-Transfer-Encoding: 7bit

I will never open the attached file without knowing you.

Rafael Lepra
  -----Mensaje original-----
  De: [e-mail]
[mailto:[e-mail]]En nombre de [e-mail]
  Enviado el: Viernes 17 de Noviembre de 2000 05:16 PM
  Asunto:



------=_NextPart_000_0000_01C05276.57B3E5C0
Content-Type: text/html;
    charset="iso-8859-1"
Content-Transfer-Encoding: quoted-printable

<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN">
<HTML><HEAD>
<META content=3D"text/html; charset=3Diso-8859-1" =
http-equiv=3DContent-Type>
<META content=3D"MSHTML 5.00.2314.1000" name=3DGENERATOR></HEAD>
<BODY>
<DIV><FONT color=3D#0000ff face=3DArial size=3D2><SPAN =
class=3D990595923-18112000>I will=20
never open the attached file without knowing you.</SPAN></FONT></DIV>
<DIV><FONT color=3D#0000ff face=3DArial size=3D2><SPAN=20
class=3D990595923-18112000></SPAN></FONT> </DIV>
<DIV><FONT color=3D#0000ff face=3DArial size=3D2><SPAN =
class=3D990595923-18112000>Rafael=20
Lepra</SPAN></FONT></DIV>
<BLOCKQUOTE dir=3Dltr=20
style=3D"BORDER-LEFT: #0000ff 2px solid; MARGIN-LEFT: 5px; MARGIN-RIGHT: =
0px; PADDING-LEFT: 5px">
  <DIV align=3Dleft class=3DOutlookMessageHeader dir=3Dltr><FONT =
face=3DTahoma=20
  size=3D2>-----Mensaje original-----<BR><B>De:</B>=20
  [e-mail]=20
  [mailto:[e-mail]]<B>En nombre de=20
  </B>[e-mail]<BR><B>Enviado el:</B> Viernes 17 de Noviembre =
de 2000=20
  05:16 PM<BR><B>Asunto:</B> =
<BR><BR></DIV></BLOCKQUOTE></FONT></BODY></HTML>

------=_NextPart_000_0000_01C05276.57B3E5C0--


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) Re:
Date: 19 Nov 2000 20:25:46 EST

>Go back and reread the messages.  I made no comment on you personally.
>I posted a response that said my experience differed from yours.
>Several others also posted that their experience did not agree with
>you.  I never said anything about you lying, or being wrong with
>what you observed.

Sophistry. Pure sophistry. You and I both know that either 2.04 crashes
frequently or it doesn't, and that nobody is likely to be mistaken in their
belief about which it does if they have used it for any length of time. So
either everyone who says it crashes a lot is lying, or everyone who says it
doesn't is lying. We can't both be right, not unless there are two
*different* UltraFractal 2.04s out there! So whereas you may not have
explicitly called me a liar, you sure as hell implied it.
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: <[e-mail]>
Subject: Re: (fractint) Re:
Date: 20 Nov 2000 14:28:08 +1300

Multiple Bogeys <[e-mail]> said:

>
> Sophistry. Pure sophistry. You and I both know that either 2.04 crashes
> frequently or it doesn't,
>
I'm sorry, I didn't realise I'd accidentally subscribed to the Ultrafractal
list.

Morgan L. Owens
"You _don't_ mean 20.4, do you."



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) Fractint version 20.1.03
Date: 19 Nov 2000 20:30:42 EST

>A new command line option has
>been added, nobof=yes, which causes the inside=bof60 and bof61 options to
>NOT recreate the images from the book of the same name.  This makes the
>behavior of these two inside options the same as the other inside options.

Could you please elaborate on this? How is it that they currently don't
behave the same as the other inside options?
_________________________________________________________________________
Get Your Private, Free E-mail from MSN Hotmail at http://www.hotmail.com.

Share information about yourself, create your own public profile at
http://profiles.msn.com.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Jason Hine" <[e-mail]>
Subject: (fractint) SOI and LogMap?
Date: 19 Nov 2000 17:48:45 -0800

Folks,

I've been playing with the SOI implementation at 20.0, and I'm delighted.  Huge
kudos to Michael Ganss and all those who worked on getting this into Fractint!
I'll apologize in advance for asking a question that's likley been asked dozens
of times on this list already: is it possible to use the SOI drawing method in
conjunction with a logmap palette?  If not, I'd like to make that an enhancement
request... might this already have been done in a more recent build?  Might
there be another way to accomplish the same thing, perhaps by creating a
truecolor=yes Targa and manipulating the pixel values in another image editing
software?  Has anyone found any workarounds?

Thanks for the fracts,
Jason



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Tim Wegner <[e-mail]>
Subject: Re: (fractint) SOI and LogMap?
Date: 19 Nov 2000 19:59:41 -0600

Jason wrote:

> I've been playing with the SOI implementation at 20.0, and I'm delighted.  Huge
> kudos to Michael Ganss and all those who worked on getting this into Fractint!

I integrated SOI (Synchronous Orbits - a technique for greartly
accelerating speed of deep zooms) into Fractint.

> I'll apologize in advance for asking a question that's likley been asked dozens
> of times on this list already: is it possible to use the SOI drawing method in
> conjunction with a logmap palette?

SOI is rather loosely integrated with Fractint. Most normal fractint
options have no effect. SOI in fractint is almost like a standalone
program, that just has a simple escape-time coloring algorithm with
few if any options that work with other fractal methods.

If fractint manages to continue to evolve (we are in a situation now
where Jonathan Osuch is the only one working on it, so
development consists only in what Jonathan is able to do),
enhancing SOI and integrating it better with Fractint would be high
on a to do list.

Since SOI is only valuable right at the limit of zooming of double
precision, a really interesting thing to do would be to extend SOI to
arbitrary precision. This might make deep zooming explorartion
more feasible.

Tim


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 20-11-00 (Cut-outs [4])
Date: 19 Nov 2000 23:28:21 -0500 (EST)


Classic FOTD -- November 20, 2000 (Rating 4)

Fractal visionaries and enthusiasts:

I have little to say about today's unassuming image.  It's a
somber picture, with the overall gloom somewhat offset by the
brilliant midget at the center.  The rings of perfectly-shaped
holes surrounding the midget inspired the name "Cut-outs".
After studying the image for several minutes, I decided that it
rated no more than a 4.

The parameter file's fast render time of 3 minutes makes up for
the slightly below average rating of the image.  If this is
still too slow, the GIF file may be found pre-rendered and ready
for download at:

          <alt.binaries.pictures.fractals>

and at:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today was cloudy and cold, with a
temperature of 36F (2C) that was far too chilly for the
disappointed fractal cats.  Since it will be even colder for the
rest of the week, the cats will have to stay disappointed.

As for myself, I'm shutting down the fractal shoppe and calling
it a night.  Until next time, take care, and who put those holes
in my fractal?


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Cut-outs           { ; time=0:03:19.87 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=+0.49255346013993960/-14.3928154883796000\
  0/570410/1/67.5 params=1/1.618034/1/16.18034/0.3/0
  float=y maxiter=1400 inside=0 logmap=49 periodicity=9
  colors=000<3>00003106607A<3>0JS0MX0Q`0Xd0ai0imOpsgrz\
  mssgpmcmiYlcSl_OjTIjPCiJ7iFCfJGcOL`SP_XSX`XTd`SidPmg\
  MrlLvpIzuFzxDzvIzvLzvOyvQuvTrvYov`j<3>vmYvpVvsQvvOvy\
  LvzI<2>ddJ_YJTQJ<2>C4J60J10J70OC6QGDTLLX<3>amifulzs0\
  zm0ug0pa0jX0dQ0`L0_sxdpviouolssjrxirfjCdfGcaJa_M`VP_\
  STYOXXJ_VGaTCfS9iQ4lP1oL9gIFaDLXASP6YJ3cD9`IFYLJVPPT\
  STXV___caaiddogisjlymo<2>zvyzyzzzzyzzuzzozz<3>YzzTzy\
  QzrMzlIzfFz_AzT7zO4zL3zI1zF<3>0z30z00z3<4>0zA0zC0zF<\
  3>1zL1zM1zO<2>0zG0zD0zC<2>0z40z10z00z00z04z0Dz1Mz3Vz\
  6dz9mzAvzDzzFyzCszAmz9gz7az4Xz3Qz1<2>9z03z00z00z07z3\
  <2>sz`rzdrzgrzjpzmpzppzsozxozzozzmzzmzzmzzmzzozz<2>p\
  zzpzzrzzrzzrzyszvszuszsdzmQzgDzcOzVYzOgzFrz7YzADzD<2\
  >4zQ1zV0z_<2>0zlLzamzT0zpAzoOzm_zllzjxzj7z00z0<7>0z0
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Guy Marson <[e-mail]>
Subject: Re: (fractint) SOI and LogMap?
Date: 21 Nov 2000 00:06:08 +0100

At 19:59 19/11/00 -0600, you wrote:
>Jason wrote:
>
>> I've been playing with the SOI implementation at 20.0, and I'm
delighted.  Huge
>> kudos to Michael Ganss and all those who worked on getting this into
Fractint!
>

....

>If fractint manages to continue to evolve (we are in a situation now
>where Jonathan Osuch is the only one working on it, so
>development consists only in what Jonathan is able to do),
>enhancing SOI and integrating it better with Fractint would be high
>on a to do list.

he, give us some examples.. where are some .par's of it?

Here is another request: Is it possible to implement ?Sylvie Gallet's
"ismand" feature (the lake like fractals) into fractint (into the x,y or z
screen) so that "ismand" can bee applyed on every fractal typ?

>
>Since SOI is only valuable right at the limit of zooming of double
>precision, a really interesting thing to do would be to extend SOI to
>arbitrary precision. This might make deep zooming explorartion
>more feasible.
>
>Tim
>
>


I got one more question: Why is there such a big jump in the following
[bailout.par] when amounting the bailout from 113 to 114? There are no
changements <113 and >114. On other Bailout Tests are other values but the
same jumps.. no changements before and after a certain value.


0-mod-113          { ; Version 2001 Patchlevel 1
  reset=2001 type=julibrot julibrotfromto=-1/-1/0/0
  julibrot3d=128/1220/60/5/10/24 julibroteyes=-5.05
  orbitname=julzpower 3dmode=lefteye
  center-mag=0/0/25/1.0003 params=0/0/4/0 maxiter=6
  bailout=113 viewwindows=4.2/0.75/yes/0/0
  colors=@altern.map
  }

0-mod-114          { ; Version 2001 Patchlevel 1
  reset=2001 type=julibrot julibrotfromto=-1/-1/0/0
  julibrot3d=128/1220/60/5/10/24 julibroteyes=-5.05
  orbitname=julzpower 3dmode=lefteye
  center-mag=-0/0/25/1.0003 params=0/0/4/0 maxiter=6
  bailout=114 viewwindows=4.2/0.75/yes/0/0
  colors=@altern.map
  }

Both are 3d-fractals for crossed-eyes viewing..
**** Remember: the floating point must be switched of! ****

Cheers,

Guy

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 21-11-00 (Fantasia in Red [6])
Date: 20 Nov 2000 23:15:48 -0500 (EST)


Classic FOTD -- November 21, 2000 (Rating 6)

Fractal visionaries and enthusiasts:

The formula 2Z^(-1.111)+2Z^(-16.67)+(1/C) is behind today's
fractal, which I decided to name "Fantasia in Red" and rate a
slightly above average 6.

There's not much to be said about the image, which speaks for
itself.  So I'll not say much, except to tell that the parameter
file is a rather slow one, taking almost 14 minutes to render.

To avoid impatience, I recommend downloading the GIF image from:

          <alt.binaries.pictures.fractals>

or from:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today was partly cloudy with a temperature
of 50F (10C) -- enjoyable outdoor conditions for the cats.  But
an intense squall struck in the afternoon, with a dramatic drop
in the temperature and flurries of snow that sent the dynamic
duo scurrying indoors.

And I'm out of energy and about to scurry for my favorite chair.
The philosophy didn't even come close today.  Maybe I'm all
philosophized out.  Regardless, we'll have another fractal
tomorrow at the regular time.  Until then, take care, and
realize that fractal images exist only because we wish them to.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Fantasia_in_Red    { ; time=0:13:47.22 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=+70.00933328451245000/+43.860611755854760\
  00/130806.7/1/-107.5 params=1/-1.111/1/-16.67/1/400
  float=y maxiter=1200 inside=0 logmap=159 periodicity=9
  colors=000AFH<3>EITEIVFIX<2>HI`HJbIIc<3>KHiKHjLGk<2>\
  MFpNFqLDt<4>SKnTLlUMkWOj<2>ZQg<2>TL_SKYQKV<3>JHMHGJG\
  FH<3>9C7CB5FA1IB3LB4OC5RE6<3>bGAeGChHDkHE<2>vIHyIIzL\
  MyIJuGGrEDmB9<3>YFGUGIRHJPHLNINLJYKKdILfGMgENiEPaDN_\
  CJQCFG<5>QELSDLUDM<2>`DObDPeEO<12>aATaATaAT<3>`9U<3>\
  HNiCQm8Tq<3>UjVZnPcrJixD<13>cdRbcSbbT<3>`XX`YW<3>Ta_\
  Rb`IYP6TB<8>QVVSVXVVZ<3>bVf<7>JidHkdEmd<3>5td<3>WvFb\
  v8hv2<12>jM9jJAjGA<3>j5CeLR`NeXPt<3>`Xh`Zfa`c<3>dhT<\
  3>Xp_VraTtbRvdPxeXztdzueztfzsszVuzTvzRszSMzb<5>Azl7z\
  x<2>AzU
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Barry N. Merenoff" <[e-mail]>
Subject: Re: (fractint) Re:
Date: 21 Nov 2000 03:52:58 -0500

Don't you get it? There's something wrong with your computer that prevent=
s
it from running UltraFractal. Other people can run UltraFractal because
their computers don't have the problem yours has. Why don't you find
someone who can help you clear up the problem, instead of naysaying
everyone who tries to mention it to you?

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 22-11-00 (Another Starfish [6])
Date: 21 Nov 2000 19:53:09 -0500 (EST)


Classic FOTD -- November 22, 2000 (Rating 6)

Fractal visionaries and enthusiasts:

I've got little to say again today.  The reason is that I'm kind
of depressed and disillusioned by the national events.  I get
these spells every now and then, but this is an unusually deep
one.  Regardless, I did work up the enthusiasm to find a fractal
image today.  I found it in the fractal that is created by the
formula Z^(-1.123)-Z^1.123+(1/C), which I chose purely on a whim.

I named the picture "Another Starfish".  I gave it this name
because I believe I have already named an FOTD "Starfish".  When
I saw the finished product, I rated it a 6, which is a bit above
average.

The draw time of the parameter file is a slow 13 minutes, making
a download of the image file far more time efficient.  The
download can be found at:

          <alt.binaries.pictures.fractals>

and in a couple hours at:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today was windy and cold, with a temperature
of 38F (3C) that was far too chilly for the fractal cats.  They
responded by spending the day by the radiators of their choice.

When I'm in this kind of a down mood, I can't philosophize, so
we have no philosophy today, (not that it's missed).  But all
things eventually come to an end, and eventually I'll find the
inspiration to spread my philosophy once again.

That's it for today.  Until tomorrow, take care, and be patient.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Another_Starfish   { ; time=0:12:55.93 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=-0.257674116207993/-0.133877987035905/4.8\
  38896e+009/1/130 params=-1/1.123/1/-1.123/0/0 float=y
  maxiter=1600 inside=0 logmap=218 periodicity=10
  colors=000KFFKFFMGJ<3>NMZUNbQOf`Qj`RnjSsmUwpUysUwpUt\
  mUqfUp`UmUUjQUi<2>FUaEU`EUYCUVBUUBVR9XO9YN1YV0Ya0`Z0\
  aY1dX4eV7fU8iSBjQEmOFnNIpMKsKMtJOzMRxFSzaVzCYzfZz9Yz\
  fYy8Yx7Yu7YuBYt5Xp4Xm4Xl3Xh3Xh1Xf1Xe1`f7dhBhjFmmJsnO\
  wqSztXzw`zxdztespfjmhbiiUfdMbZF`U8XU1UUFdUSmUewUqzFp\
  zJnzN<2>lzZlzbjzfizjiznhzsfzwfzyeztdypdulbqhbmdai`ae\
  V`aR`YNZUJ<2>YI7`G8aF9bE9dCBeBBf9Ch8Ci7Ej5El4Fm3Fp1G\
  q0I<3>w0Kx0Ky0M<3>z0Oz0Oy0Q<3>t0Ss0Sq0Up0Un1Vm3Vl4Xj\
  4Xi5Yh7Yf8Ze8Zd9`bB`aCa`CaZBYYBVXBSXBQVBNUBKSBIS9FR9\
  CQ99O97O94N91M90M90NB0<2>OB0OB1QB3<2>RC5RC5RC7SC8SC8\
  UC9UEBUEBVECVEEVEEXEFXEGXEGVIEUKCUNBSQ9SU8UX5VZ4Xa3Y\
  e1Zh0`j0<2>dt0ew0fy0hz0iw0jq0lt0mt3nt7pt9qtEstG<3>xt\
  UztYzt`<2>zxdzyezzezz`zzXzzRzzNzzIzzEzz8zz4zz0<2>zz0\
  <3>zz9zzCzzFzzIzzJzzMzzF<4>zzF
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Gedeon <[e-mail]>
Subject: (fractint) updated website
Date: 21 Nov 2000 22:49:16 -0500

This is a multi-part message in MIME format.

------=_NextPart_000_0017_01C0540D.469BD660
Content-Type: text/plain;
    charset="iso-8859-1"
Content-Transfer-Encoding: quoted-printable

I invite you to visit my Euler Gallery, Pages 1 & 2, where I have =
uploaded 16 new images. The parameters are available for download.=20

Regards,

Gedeon
FRACTALS: http://members.nbci.com/gedeonp/fractals.html
Last updated: November 21, 2000
Member Infinite Fractal Loop
PHOTOGRAPHY: http://members.nbci.com/gedeonp/photos.html
Last updated: July 10, 2000

------=_NextPart_000_0017_01C0540D.469BD660
Content-Type: text/html;
    charset="iso-8859-1"
Content-Transfer-Encoding: quoted-printable

<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN">
<HTML><HEAD>
<META http-equiv=3DContent-Type content=3D"text/html; =
charset=3Diso-8859-1">
<META content=3D"MSHTML 5.50.4134.600" name=3DGENERATOR>
<STYLE></STYLE>
</HEAD>
<BODY bgColor=3D#ffffff>
<DIV><FONT face=3D"Trebuchet MS" size=3D2>
<DIV><FONT face=3D"Trebuchet MS" size=3D2>
<DIV><FONT face=3D"Trebuchet MS" size=3D2>I invite you to visit my =
Euler=20
Gallery, Pages 1 & 2, where I have uploaded 16 new images. The =
parameters=20
are available for download. </FONT></DIV>
<DIV> </DIV></FONT><FONT face=3D"Trebuchet MS" =
size=3D2></FONT></DIV>
<DIV><FONT face=3D"Trebuchet MS" size=3D2>Regards,</FONT></DIV>
<DIV><FONT face=3D"Trebuchet MS" size=3D2></FONT> </DIV>
<DIV><FONT face=3D"Trebuchet MS" =
size=3D2>Gedeon</FONT></DIV></FONT></DIV>
<DIV><FONT face=3D"Trebuchet MS"=20
size=3D2>--------------------------------------------------------------<B=
R>FRACTALS:=20
<A=20
href=3D"http://members.nbci.com/gedeonp/fractals.html">http://members.nbc=
i.com/gedeonp/fractals.html</A><BR>Last=20
updated: November 21, 2000<BR>Member Infinite Fractal =
Loop<BR>PHOTOGRAPHY: <A=20
href=3D"http://members.nbci.com/gedeonp/photos.html">http://members.nbci.=
com/gedeonp/photos.html</A><BR>Last=20
updated: July 10,=20
2000<BR>--------------------------------------------------------------</F=
ONT></DIV></BODY></HTML>

------=_NextPart_000_0017_01C0540D.469BD660--


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) C-FOTD 21-11-00 (Fantasia in Red [6])
Date: 22 Nov 2000 01:19:00 -0500

I hate to say it but something's wrong with the FOTD again -- and it isn't
just some delay. The individual FOTDs are there (at least, those that are in
my browser history still -- including ones not cached anymore), but the
index page http://home.att.net/~Paul.N.Lee/FotD/FotD.html is 404. This looks
like a case of vandalism. I suggest you re-upload the index page and hit
your ISP's customer service people over the head with the Cloobat(tm). Your
ISP obviously hasn't been keeping the security patches of their Web server
up to date, or else one of their employees is disgruntled and committing
acts of sabotage. If the ISP does not respond to your complaints in a
satisfactory manner I suggest changing to another provider.
_____________________________________________________________________________________
Get more from the Web.  FREE MSN Explorer download : http://explorer.msn.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) Re:
Date: 22 Nov 2000 01:26:37 -0500

>Don't you get it? There's something wrong with your computer that prevents
>it from running UltraFractal.

Yeah, right. Everything else works, just not UltraFractal. If something were
wrong with the machine or the OS, nothing would work, or at least lots of
things wouldn't work. If a single app isn't working, and everything else
works fine, I'm forced to conclude that the app is the problem, and not the
system.

I am aware that memory or overheating errors often don't show themselves
until you do something really compute-intensive, such as compiling a Linux
kernel. However, I run stuff that stresses the system a lot more than
UltraFractal does -- Quake grinds the cpu, memory, and video system hard,
Fractint really grinds the cpu, etc. Also, I run Prime95 -- if there were a
memory fault or a similar problem, it would be showing up as errors there.
Prime95 plays with all of the memory on the machine, and is very sensitive
to memory/cpu problems. As for OS problems or video problems, they'd affect
every graphical app on my system.
_____________________________________________________________________________________
Get more from the Web.  FREE MSN Explorer download : http://explorer.msn.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: davides <[e-mail]>
Subject: Re: (fractint) C-FOTD 21-11-00 (Fantasia in Red [6])
Date: 22 Nov 2000 05:34:12 -0500

At 01:19 AM 11/22/2000 -0500, you wrote:
>I hate to say it but something's wrong with the FOTD again -- and it isn't
>just some delay. The individual FOTDs are there (at least, those that are in
>my browser history still -- including ones not cached anymore), but the
>index page http://home.att.net/~Paul.N.Lee/FotD/FotD.html is 404. This looks
>like a case of vandalism. I suggest you re-upload the index page and hit
>your ISP's customer service people over the head with the Cloobat(tm). Your
>ISP obviously hasn't been keeping the security patches of their Web server
>up to date, or else one of their employees is disgruntled and committing
>acts of sabotage. If the ISP does not respond to your complaints in a
>satisfactory manner I suggest changing to another provider.

Strange - worked for me, right from the link given above.
[e-mail]
Give a man a fish and he eats for a day....
Teach a man to fish and he spends his whole day drinking beer!!!


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Osher Doctorow" <[e-mail]>
Subject: (fractint) Virus cleaned out - thanks for warning - Doctorow
Date: 22 Nov 2000 15:11:57 -0800


Thanks to warning from fractint and its affiliates in charge of virus
protection, I was able to eliminate my computer's virus within 48 hours.  It
had infected the entire Windows 98, which required re-installing a new
version of Windows 98.  I now have a virus protection which I update every
few days.  According to computer experts, viruses are so frequent in the USA
that antivirus (AV) programs need to be updated every week.  I had
previously (about a year ago) been infected by a Kak virus, which was
cleaned out but left behind an alteration in my registration and signature
components and gave occasional false alarms.   Windows is especially
susceptible to the Kak virus.

It is a curious fact that I sent an email to fractint concerning mathematics
in studying biological/medical viruses when the virus hit my computer, but
it is also a good example of the fact that people should not be assumed to
be guilty even when coincidences occur (which they do more often than is
generally believed).  If anybody had bothered to ask me, I would have told
them that I have never been a computer programmer or computer engineer (I do
consult in mathematics/statistics and physics) and therefore could not
possibly create a computer virus.  They could have checked my employment
references.  What I am guilty of is belonging to very many internet
discussion groups/mailing lists, and presumably that is where I got the
virus on both occasions (although I have also run into "flames", so there is
more than one route to get a virus theoretically).   The benefit of
belonging to such groups is that I am more inspired to do creative research
in mathematics, and I will try to continue along that path.

Osher Doctorow


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 23-11-00 (Fractalesque [7])
Date: 22 Nov 2000 23:39:58 -0500 (EST)


Classic FOTD -- November 23, 2000 (Rating 7)

Fractal visionaries and enthusiasts:

A descriptive name for today's fractal eluded me, so I settled
on the generic title "Fractalesque".  The name has a rather
festive sound to it, which goes along with the festive
appearance of the image.  And it's better than no name at all.

Due to the unusual blue and orange elements surrounding the
brilliantly decorated central midget, I raised my rating from 6
to 7.

The formula behind the image is Z^1.5+0.1Z^(-15)+(1/C), another
of the totally whimsical expressions I conjure up while using
the MandelbrotMix4 formula.

The parameter file renders in 9-1/2 minutes, a time long enough
to make a download of the GIF image file the better choice.  And
speaking of a download, the file may be found on Usenet at:

          <alt.binaries.pictures.fractals>

and on the W.W.W. at:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today here at Fractal Central was sunny but
quite cold.  The temperature of 30F (-1C) was far too chilly for
the fractal cats, who slept curled by the radiators most all day.

I've still got more fractal image inspiration than literary
inspiration, so there will be no philosophy for today.  For
tomorrow? -- only time will tell.

And I see that the time has arrived to shut down the fractal
shoppe and call it a night.  Until next time, take care, and
wish for the best.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Fractalesque       { ; time=0:09:38.32 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=-14.18706546711465000/-0.2322107332456753\
  0/2.592652e+007/1/77.5 params=10/1.5/1/-15/-0.9/0
  float=y maxiter=2000 inside=0 logmap=172 periodicity=9
  colors=00080LD0NH0LK1JO3HR6EV8DZA9aD8eH6jK2oO0sR0xU0\
  zT0zQ5zO9zKEzIJzGOzDPzAPy9Lx8Jw6Gv5Du39s17r03r01<3>p\
  5Op6Uo7_o8eo9jmApmCvmDzkIojNcgRRfWGe_5`c3Wf3Rh3Ol3Up\
  3_r3<3>ws2zs2ws2<2>es2hs2ks2fm8aeEYUJTLPODUJ5_G0dK0a\
  O2`<2>ZAWaDVeHThJRlLQ<2>m`RmeRojR<2>oxRozRmgYmNcoJ_o\
  HWoEUoCQo9Oo6K<3>o6Zo6ao6em6hm6hm2kl6jk9hjDhjHghKggO\
  fgQffPcfOwfNzfLV<3>fHKfGIfEEfDCfD9gN6hW2he0jo0jx0<2>\
  fv0eu0es1ds2cr3ar5<3>Zo9ZoAAmzGkx<3>Ya`a_UfYO<3>wO0<\
  3>jQEfRIdRL`TPYTR<3>LVeIWhEWlCWoG_`IcOKfANj0Qh2Uh7Wg\
  C_gHcfKefPheUleZodcrdfvckxcpzauzaxgK`<2>6Od<12>6cs6d\
  u6ev<3>6jz6kz6lz<2>6pz6qz6qz<11>6qz6qz6qz<3>6qzAqz<1\
  8>8qz
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Andrew Coppin" <[e-mail]>
Subject: Re: (fractint) C-FOTD 23-11-00 (Fractalesque [7])
Date: 23 Nov 2000 11:24:27 -0000

Wow! Now *that* is what I call a colour scheme. Fantastic! Jim, you are an
inspiration to us all!


>From: Jim Muth <[e-mail]>
>Reply-To: [e-mail]
>To: [e-mail]
>CC: [e-mail]
>Subject: (fractint) C-FOTD 23-11-00 (Fractalesque [7])
>Date: Wed, 22 Nov 2000 23:39:58 -0500 (EST)
>
>
>Classic FOTD -- November 23, 2000 (Rating 7)
>
>Fractal visionaries and enthusiasts:
>
>A descriptive name for today's fractal eluded me, so I settled
>on the generic title "Fractalesque".  The name has a rather
>festive sound to it, which goes along with the festive
>appearance of the image.  And it's better than no name at all.
>
>Due to the unusual blue and orange elements surrounding the
>brilliantly decorated central midget, I raised my rating from 6
>to 7.
>
>The formula behind the image is Z^1.5+0.1Z^(-15)+(1/C), another
>of the totally whimsical expressions I conjure up while using
>the MandelbrotMix4 formula.
>
>The parameter file renders in 9-1/2 minutes, a time long enough
>to make a download of the GIF image file the better choice.  And
>speaking of a download, the file may be found on Usenet at:
>
>           <alt.binaries.pictures.fractals>
>
>and on the W.W.W. at:
>
>           <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>
>
>The fractal weather today here at Fractal Central was sunny but
>quite cold.  The temperature of 30F (-1C) was far too chilly for
>the fractal cats, who slept curled by the radiators most all day.
>
>I've still got more fractal image inspiration than literary
>inspiration, so there will be no philosophy for today.  For
>tomorrow? -- only time will tell.
>
>And I see that the time has arrived to shut down the fractal
>shoppe and call it a night.  Until next time, take care, and
>wish for the best.
>
>
>Jim Muth
>[e-mail]
>
>
>START 20.0 PAR-FORMULA FILE================================
>
>Fractalesque       { ; time=0:09:38.32 -- SF5 on a P200
>   reset=2001 type=formula formulafile=critical.frm
>   formulaname=MandelbrotMix4 function=recip passes=1
>   center-mag=-14.18706546711465000/-0.2322107332456753\
>   0/2.592652e+007/1/77.5 params=10/1.5/1/-15/-0.9/0
>   float=y maxiter=2000 inside=0 logmap=172 periodicity=9
>   colors=00080LD0NH0LK1JO3HR6EV8DZA9aD8eH6jK2oO0sR0xU0\
>   zT0zQ5zO9zKEzIJzGOzDPzAPy9Lx8Jw6Gv5Du39s17r03r01<3>p\
>   5Op6Uo7_o8eo9jmApmCvmDzkIojNcgRRfWGe_5`c3Wf3Rh3Ol3Up\
>   3_r3<3>ws2zs2ws2<2>es2hs2ks2fm8aeEYUJTLPODUJ5_G0dK0a\
>   O2`<2>ZAWaDVeHThJRlLQ<2>m`RmeRojR<2>oxRozRmgYmNcoJ_o\
>   HWoEUoCQo9Oo6K<3>o6Zo6ao6em6hm6hm2kl6jk9hjDhjHghKggO\
>   fgQffPcfOwfNzfLV<3>fHKfGIfEEfDCfD9gN6hW2he0jo0jx0<2>\
>   fv0eu0es1ds2cr3ar5<3>Zo9ZoAAmzGkx<3>Ya`a_UfYO<3>wO0<\
>   3>jQEfRIdRL`TPYTR<3>LVeIWhEWlCWoG_`IcOKfANj0Qh2Uh7Wg\
>   C_gHcfKefPheUleZodcrdfvckxcpzauzaxgK`<2>6Od<12>6cs6d\
>   u6ev<3>6jz6kz6lz<2>6pz6qz6qz<11>6qz6qz6qz<3>6qzAqz<1\
>   8>8qz
>   }
>
>frm:MandelbrotMix4 {; Jim Muth
>a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
>g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
>k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
>z=k*((a*(z^b))+(d*(z^f)))+c,
>|z| < l
>}
>
>END 20.0 PAR-FORMULA FILE==================================
>
>
>--------------------------------------------------------------
>Thanks for using Fractint, The Fractals and Fractint Discussion List
>Post Message:   [e-mail]
>Get Commands:   [e-mail] "help"
>Administrator:  [e-mail]
>Unsubscribe:    [e-mail] "unsubscribe fractint"

_____________________________________________________________________________________
Get more from the Web.  FREE MSN Explorer download : http://explorer.msn.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 24-11-00 (Liquid Mandeloid [6])
Date: 24 Nov 2000 00:30:05 -0500 (EST)


Classic FOTD -- November 24, 2000 (Rating 6)

Fractal visionaries and enthusiasts:

After a busy Thanksgiving day holiday, I have little time for
notes, though the fractal for today is notable.  The iterated
formula behind the image is -15Z^(-1.15)-Z^(-11.5)+(1/C),
another totally whimsical expression.

I named the image "Liquid Mandeloid" when I noticed that the
entire image appears as though it were reflected in a rippling
pool of water.  Having named the picture, I studied it a moment
before deciding on its rating of 6.

With a render time of almost 47 minutes, the image is quite slow
when drawn from the parameter file.  But impatience may be
avoided by downloading the pre-rendered GIF image file from the
internet, where it has been posted to:


          <alt.binaries.pictures.fractals>

and to:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today here at Fractal Central was cold and
sunny.  The afternoon temperature of 34F (1C) was far too cold
for sensitive fractal cats to be out of doors.  They spent the
day as usual by the radiators.

That's it for tonight, but I'll be back tomorrow with fractal
and notes.  Until then, take care, and could a race that had
never developed vision be familiar with the Mandelbrot set?


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Liquid_Mandeloid   { ; time=0:46:27.52 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=+2.71630165554769200/-0.94733691371325090\
  /3.034843e+008/1/180 params=15/-1.15/1/-11.5/-2/500
  float=y maxiter=3600 inside=0 logmap=364 periodicity=9
  colors=000REEUFFWGGdHH<3>KMMFOO6PPAQQCRR<2>MVVPWSSWR\
  VYPYYO`ZLc_Jg_Hi`Fm`EobBsbAvc7zd1xc6vcArbEobHmbHibFh\
  bFjbEkbEmbCn`C<3>s`Bt_Bv_Aw_Ax_At`Br`Co`E<2>h`Ge`Hc`\
  J<3>U`MR`MP`OM`PK`QJcOH`QG_RFZSEWVCVWBUYAR_8Q`7Pb6Oc\
  5Le4Kg2Jh1Gj0Fk0Em0Cn<3>5Bi6Ah7Ag8AeAAdC6bBAcBCcBFcA\
  HcALcAOc8Qc8Sc8Wd7Zd7`d7cd6gd6id6kd1qg6nd<2>HjZkiWPh\
  VtgSWeRtdPdcMx`Li`JzYGnZFwYCsWBvVBxUBwUBvSBsSBrRBoRB\
  nQBmQBoOFqLHrKLsHOtFRvEUwBYxA_y7cz5ez4iz1kz0oz0rz0vz\
  0xz0wz2w<3>zHwyLwxPwxUw<3>shwrkwqowoswnyzowwovsqtqqs\
  mrqirogrncsm`sjYtiUthRvgOvdKvcH<3>xY4yW1yV0yU0rV0<3>\
  U_KO`PMbEHcU0d07eFLgUZhh_ii`ji`kibmi<3>eriesigti<3>j\
  yijzikziozkkziizggzddzb`z_ZzYWzV<3>LzLJzJGzGCzE<2>5z\
  60z52z45z4<5>Gz4Hz4Kz4Lz4Oz4Pz4Rz4Sz4Vz4Wz4RzCMzLGzQ\
  JzSKzUMzV
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Jonathan Osuch" <[e-mail]>
Subject: Re: (fractint) SOI and LogMap?
Date: 24 Nov 2000 10:26:13 -0600

Guy,

> I got one more question: Why is there such a big jump in the following
> [bailout.par] when amounting the bailout from 113 to 114? There are no
> changements <113 and >114. On other Bailout Tests are other values but the
> same jumps.. no changements before and after a certain value.

If you set those parameters (params=0/0/4/0 bailout=113) in the julzpower
type and switch back and forth between floating point and integer math,
you'll notice that what you are looking at are artifacts due to the limited
dynamic range of the integer math.  This carries over into the julibrot
fractal type.  I wouldn't worry about why the big jump occurs since the
integer math routines will be going away eventually.

Jonathan



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Harry Bissell <[e-mail]>
Subject: Re: (fractint) SOI and LogMap?
Date: 24 Nov 2000 11:38:17 -0500

<delurk mode>

Integer modes going away ???

Will it be called FractFloat (or similar) then ???

<lmo>

H^) harry

Jonathan Osuch wrote:

> Guy,
>
> > I got one more question: Why is there such a big jump in the following
> > [bailout.par] when amounting the bailout from 113 to 114? There are no
> > changements <113 and >114. On other Bailout Tests are other values but the
> > same jumps.. no changements before and after a certain value.
>
> If you set those parameters (params=0/0/4/0 bailout=113) in the julzpower
> type and switch back and forth between floating point and integer math,
> you'll notice that what you are looking at are artifacts due to the limited
> dynamic range of the integer math.  This carries over into the julibrot
> fractal type.  I wouldn't worry about why the big jump occurs since the
> integer math routines will be going away eventually.
>
> Jonathan
>
> --------------------------------------------------------------
> Thanks for using Fractint, The Fractals and Fractint Discussion List
> Post Message:   [e-mail]
> Get Commands:   [e-mail] "help"
> Administrator:  [e-mail]
> Unsubscribe:    [e-mail] "unsubscribe fractint"


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) Re: C-FOTD 23-11-00
Date: 24 Nov 2000 17:23:54 -0500 (EST)

At 11:24 AM 11/23/00 -0000, Andrew Coppin wrote:

>Wow! Now *that* is what I call a colour scheme. Fantastic! Jim, you
>are an inspiration to us all!

I'm glad you enjoyed my modest effort.  It's too bad that my literary
inspiration is currently lagging so far behind my fractal luck.  But
I've had these fallow periods before.  They always pass eventually.

C-FOTD to follow in a few hours.  Until then, take care, and do we
find fractals or create them?

Jim M.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 24-11-00 (Heliosphere [6])
Date: 24 Nov 2000 18:54:32 -0500 (EST)


Classic FOTD --  November 25, 2000 (Rating 6)

Fractal visionaries and enthusiasts:

Today's fractal reminds me of a cross section of the sun, with
its churning plasmas and magnetic fields.  This is why I named
it "Heliosphere".  Studying the image, I considered rating it a
7, but due to my continuing down mood, I rated it a 6, which is
above average but not outstanding.

The image was created by iterating the fractal formula
-15Z^(-1.15)-Z^(-11.5)+(1/C), with the escape radius set at 600.
These are the same parameters as those of yesterday's "Liquid"
fractal, and today's image is therefore part of the same fractal
as yesterday's.

The parameter file render time of 14-plus minutes is faster than
yesterday's, but still slow enough to make the easy download the
better choice.  That download may be found on Usenet, posted to
the binary group:

          <alt.binaries.pictures.fractals>

In an hour or so, the image will also be available on Paul Lee's
web site at the URL:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The weather today here at Fractal Central moderated from the
unseasonable cold that has prevailed most of this week.  The
temperature of 40 however was still far too chilly for the
dynamic duo of fractal cats, who chose to pass the afternoon on
their blanket by the big radiator.  At least the cats were happy.

As for me, I'm still in my melancholy mood, which affects my
literary inspiration much more than my fractal luck.  Strangely
enough, I'm not sure why I'm so unsettled.  The doldrums may
wear off by tomorrow, though I'm not counting on it.

Regardless, I'll return in 24 hours with another fractal, and if
I have no philosophy, I'll have at least a few words about the
fractal.  Until then, take care, and be of good cheer.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Heliosphere        { ; time=0:14:13.55 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=+0.4654990346770224/-3.884180985250454/61\
  65647/1/29.999 params=15/-1.15/1/-11.5/-2/500 float=y
  maxiter=3600 inside=0 logmap=227 periodicity=10
  colors=000000000000<3>0000000000000000000200400840AA\
  0EE2GH6JNALREPXHR`LVdPXiT`mVboL`qPZr<2>`RudPqgRokVko\
  Xgs`dvb`zc_<3>ohWliVijU<2>`mR<2>PsXLuZHvZEx`Azb6zd2z\
  e0zg0zi0zk0zk0zg0ze0zd4zb8z`CxX<2>PsRTqPXoL<3>kgEdeC\
  ZdARbAL`8EZ68X60V40T20R20T00V00X04X08Z0C`0E`0GV6HPGH\
  LPJG`LAiL6sN0zP0zP0zV0z<3>i0zm0zq0xu0ux0qz0mz0iz0ez0\
  bz0`<2>z0kv6oqGskNvgXzbdzXmzTuzNzzHzzEzzGzzHzzHzzJzz\
  JuzLqvLksNgoNdkCTe0Jb08Z00V0CP8NLNZHbkEqvAzz6zzEzzJz\
  zPzzXzzbzzgzzozwuzszzmzzmzzAzzAzxAzsismmigs`bxTXzJRz\
  ALz2Gz0Az0Cz0Ez0Ez6GzCGzJHzPHzXJzbJziLzoLzuZiviNvv0x\
  z0xz0qx0iu0b<3>dV8`b0Xi0Tq0Px0Lz0Nz0Pz0Pz0Rz0Tz0Tz0V\
  z0Vz0Pz4JzCGzLAzT6zb0zi0zs0zz<2>0zz0zz0zx<2>0zN6zJEz\
  HLzGTzE`zA<2>vz4zzzqzzgzzZzoPzd<2>0z60z0<2>0z00z60zN\
  4zdLzNbz8dzA<4>mzAozAqzC0zA0z8
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) Re: C-FOTD 23-11-00
Date: 24 Nov 2000 17:23:54 -0500 (EST)

At 11:24 AM 11/23/00 -0000, Andrew Coppin wrote:

>Wow! Now *that* is what I call a colour scheme. Fantastic! Jim, you
>are an inspiration to us all!

I'm glad you enjoyed my modest effort.  It's too bad that my literary
inspiration is currently lagging so far behind my fractal luck.  But
I've had these fallow periods before.  They always pass eventually.

C-FOTD to follow in a few hours.  Until then, take care, and do we
find fractals or create them?

Jim M.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) Re: C-FOTD 23-11-00
Date: 25 Nov 2000 05:49:09 -0500

>Wow! Now *that* is what I call a colour scheme. Fantastic! Jim, you
>are an inspiration to us all!

Seconded.
_____________________________________________________________________________________
Get more from the Web.  FREE MSN Explorer download : http://explorer.msn.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: [e-mail]
Subject: (fractint) 3-D pars
Date: 25 Nov 2000 16:35:54 EST

One of my favorite aspects of Fractint 20.0 is its option of making 3-D
images, stereo pairs and random dot stereograms. Unfortunately, I have not
found a way to make parameter files of them. A couple years ago, Les Sinclair
posted to the List some 3-D transforms by using pairs of pars, but even that
option seems to be unavailable to stereo pairs and stereograms. Can someone
help?

Lee Lane

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 26-11-00 (Study Number One [5])
Date: 25 Nov 2000 21:34:46 -0500 (EST)


Classic FOTD -- November 26, 2000 (Rating 5)

Fractal visionaries and enthusiasts:

At first glance, the formula Z+1/Z+1/C would not appear to have
much potential for creating fractals.  But as today's image
shows, in the world of fractals, things are not always as they
would appear.  The formula actually creates quite an unusual
fractal, filled with midgets surrounded by caterpillar-like
spirals.

Unable to think of an alternate name for today's fractal, and
not wanting to name it "Caterpillars", I gave it the technical
name "Study-01", which like "Symphony in E flat major" is
nothing more than a description by which the work may be
indexed.  The rating of 5 reasonably represents this average-
quality fractal.

The 5-1/2 minute render time is a bit slow.  The cure is to
download the file of the already-rendered GIF image from:

          <alt.binaries.pictures.fractals>

or from:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today was cloudy and cold.  At nightfall a
steady light rain set in, which is still continuing.  The day
was unpleasant enough for humans; for fractal cats it was
unbearable.  The cats passed the day sprawled by the warmest
radiators they could find.

And I'm going to pass the rest of the evening in my traditional
Saturday evening routine -- watching a junky old sci-fi or
horror movie on TV.

I shall return tomorrow.  Until then, take care, and if the
universe is a great accident, who or what had the accident?


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Study_Number_One   { ; time=0:05:39.33 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=+0.26049780581950650/-0.00067297120701050\
  /3.805436e+007/1/169.999 params=1/1/1/-1/-2.5/200
  float=y maxiter=1400 inside=0 logmap=78 periodicity=9
  colors=0000BC<2>0D70E60F30G1<3>0K00L00M0<2>1P0<3>KS0\
  MS0RT0VV0_V0aW0fW0jY1n_3q_4v`6z`7za9zd6<2>zYFzVIxTLv\
  RO<2>nKinIpmIwqOzwTzzfzz_zvSzpLwjDpd6ia7a_9WY9VVATTA\
  SRCSOCRMDPKDOIFMHFMHHMIHMIHMKHMLHTPHTVHVWHVYH__HV_HS\
  _HP_HMYIIYKFYKCYL9YM4YO1YP0YP0`R1cS7fSCiTIkVMnVSqWWt\
  WawYfz_kz_pz`vzYzz`z<3>zfszap<2>zPkzLizIgzDfz9dx4aw0\
  `v0_t0Y<5>t0ft0gt0it0jt0kt0mt0m<3>t0st0tt0vt0wt0xt0z\
  <2>t0zp0zk4zgAxdFx`LwWPvSVtP_tLdsHiqCnp9sp4xn0zm0zn0\
  zm0zk<2>0zi0zi1zg1zg1zf3zd3zd4zc4zc6za<2>7z_7z_9zY9z\
  W<2>AzVHzTLzSPwRTsPVnO<2>VaKVfH<2>_sC`wAaz9cz1dx0<3>\
  jv0kx1mzC<3>szptzzvzzwzzxzzzzwzzszxn<2>znazkYziTzdPz\
  aLz_HzWCzT7zV4zi7zw9zzCzzD<3>zzCzzCzwC<3>zkCziCzfCzg\
  FzgHziKziLziO<2>zjTzkVzkYzk_zmazmczmdzkfzjgziiziizii
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Karl Simanonok <[e-mail]>
Subject: (fractint) Universe
Date: 25 Nov 2000 23:29:15 -0800

Hi Jim,

This is a really great quote.  Are you the originator, or is it someone
else's?

Regards,

Karl S.

At 09:34 PM 11/25/2000 -0500, you wrote:
>if the universe is a great accident, who or what had the accident?



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: [e-mail]
Subject: (fractint) Re: Universe
Date: 26 Nov 2000 12:46:46 EST


I wrote in the FOTD of 26-11-00

<If the universe is a great accident, who or what had the accident?>

Karl replied:

<<
 Hi Jim,

 This is a really great quote.  Are you the originator, or is it someone
 else's?

 Regards,

 Karl S.
  >>

The quote is original with me.  I thought of the quote about 10 seconds
before I wrote it.  But I do a lot of reading about such topics, and I could
have picked it up from some forgotten source.

Jim M.

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 27-11-00 (Square Roof of Two [5])
Date: 27 Nov 2000 00:22:51 -0500 (EST)


Classic FOTD -- November 27, 2000 (Rating 5)

Fractal visionaries and enthusiasts:

Today's C-FOTD is named "Square Root of Two".  The reason is
that the exponent of Z is sqrt(2).  I rated the picture a 5
because I doubt that it is worth any more than that.

To add to the interest, I calculated a part of the image far out
in a negative direction on the infinite spiral of the complex
logarithm.  The value of -1234567890 that I entered is totally
whimsical, and why not?  Doing things on a whim is great fun.

Though midgets of order 1.414... are hard to find, the search,
as today's image illustrates, can be worth the effort.  The draw
time of the parameter file is a slow 11-3/4 minutes; the down-
load time is far shorter.  Look for the download on Usenet at:

          <alt.binaries.pictures.fractals>

and in an hour or so on Usenet at:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today here at Fractal H.Q. was cloudy in the
morning, with intermittent heavy showers, followed by clearing
in the afternoon.  The temperature of 56 brought out the cats,
though the wet grass dampened their adventurous spirits.

And I, having my spirit dampened by world events, am ready to
shut down the fractal shoppe and declare the day closed.  Until
tomorrow, take care, and then take even more care.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

Square_Root_of_Two { ; time=0:11:47.44 -- SF5 on a P200
  reset=2001 type=formula formulafile=branchct.frm
  formulaname=MandelbrotBC passes=1
  center-mag=+0.7234134339563163/-0.1756656620377885/6\
  71159.7/1/-22.5 params=1.414213562373/0/-1234567890/0
  float=y maxiter=50000 inside=0 periodicity=10
  colors=0004Ag38k28n07r07v06y06z04z04zSBizHKzHI<2>zI8\
  zNHzSOyYXwabaaE_bBZcAXe7Vf4Ug3Qf7NeAJeDHcH<2>7bOBaRF\
  aUJ_XM_ZQZaUZcXYf_YicXkgXnjVqnVsrUvuUyySzzSzzSznIzZ7\
  uJ0oK4j<2>KOYKVUMbOMiKMoHMvBMz7Mz3Nz8NrEOiJOaOQSU<2>\
  R3gF2U30H84KD7OIASMDXRF_VIc_KgcOjiRn<2>vZzzazzczzfzz\
  gzvgzogwigsbgoXij<3>6iVAgX<4>NfbQfcSfeVffYffaeg<2>ie\
  kkemncnqcoscqvcrycrzeszeu<2>zfvzfwzgy<2>zgzzkyzoyzrw\
  zvwzzwzzvzzvzzvzzszzqzznzzmzyjzvgzufzrczqaznZzmYzjVz\
  iSzfRzeOzbMzaJzZIzYFzVDzVA<2>zUBvSBsSBoSBmRBiRBfRBbR\
  BZQDXQDSQDQODMODJODFNDDND8ND07H6NDHaARo7ez0az4YwAVrF\
  RkMOfRK_XIVaEOg<2>47w84yD2yH0yK0yO0zN0yN0vN0sN0qN0mN\
  0jN0gN0eN0aN0ZN0X<2>N0NN0KN0IN0E<3>N03K07J3BI7EHAIFE\
  KEHODJS<2>8Ua7Xe6ZgAagDbgFcgIfgMggOigRkgUmgYng_qgbrg\
  esgbzigugenZkefqXnJFHIEJHENEDRDDUBBY8Ba7Ac
  }

frm:MandelbrotBC = { ; Z = Z^E + C
  e=p1
  p=real(p2)+PI
  q=2*PI*trunc(p/(2*PI))
  r=real(p2)-q
  Z=C=Pixel:
    Z=log(Z)
    IF(imag(Z)>r)
      Z=Z+flip(2*PI)
    ENDIF
    Z=exp(e*(Z+flip(q)))+C
  |Z|<100
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Andrew Coppin" <[e-mail]>
Subject: (fractint) C-FOTDs
Date: 27 Nov 2000 10:29:09 -0000

Te he... The Square Roof of 2?
                       ^

Erm, sorry for my stupidity, but wouldn't Z+1/Z+1 = 1? In that case,
Z+1/Z+1/C reduced to 1/C. Or is the entire fractal the result of some
internal artifact of FractInt's parser logic or something? Maybe I'm just
dense...

BTW, I've come up with a formula that does something very strange. I was
working on the formula Z = Z^3 - 3(A^2)Z + B, which is apparently the
generalized form of the cubic equation. (OK, whatever.) Anyway, drawing
Julias is fine, but drawing the Mandelbrot set poses a problem. The formula
has two critical points to iterate: +A and -A. The Mandelbrot set is the
intersection of the two sets generated by iteration these two start points.
Fine, I thought. I'll have two iteration variables.

Anyway, the formula works, but it does something I've never seen before.
With the right colour scheme (bud1.map), for certain parameters you get a
scene involving a very mangled pair of Mandelbrot sets. Closer inspection
reveals that parts of the lace-like structures that radiate out from all
Mandeloids is "missing". But there is still a very faint "shaddow" of the
fronds. Very spooky. I don't have the formula with me right now, but as soon
as I can I'll post pars. (The other interesting thing is that you get
well-formed Mandelbrots that are disconnected.)

Andrew.

_____________________________________________________________________________________
Get more from the Web.  FREE MSN Explorer download : http://explorer.msn.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Lee Skinner <[e-mail]>
Subject: (fractint) C-FOTDs
Date: 27 Nov 2000 07:13:13 -0500

I'd love to see those pars, Andrew.  Here's one for you (slow, but worth
it!)

61124009           { ;                                       t=3D  5:03:0=
3.47
                     ; on a P233 at 1600x1200  Nov 27, 2000  05:07:51
                     ; Image Copyright 2000 by Lee H. Skinner ver=3D2001
                     ;  Version 2001 Patchlevel 3
  reset=3D2001 type=3Dformula formulafile=3Dfractint.frm
  formulaname=3Dmandelbrotmix4 function=3Drecip passes=3D1
  center-mag=3D+2.71707619839821900/-0.94866867868312280/5936.513/1/-122.=
5
  params=3D15/-1.15/1/-11.5/-2/500 float=3Dy maxiter=3D3600 inside=3D0
  logmap=3D231 symmetry=3Dnone periodicity=3D9
  colors=3D000Mg2Mg2Lh1<40>ul1vl1wl1xl1yl1zm0<29>zF0zE0zD0<2>zA0z80z82<13=
>z4\
  bz3ez3g<3>z2r<3>zmxzzzruz<3>N`zFWz6Qz<3>SLmYKicJf<3>pKcsKbvKazL`<6>zQPz=
R\
  NzRL<3>zUD<3>nI9jF8gC6<3>V01<2>yB3<14>yfAyhByjB<2>ypDysEytF<2>zwHzwIzvK=
<\
  3>zuQ<3>cvnYwuXvu<4>OpvNnvLmw<3>Ehx<3>8Th7Pd5L`<2>08P<3>9IJBLHDNG<3>NY9=
<\
  30>Mg2
  }

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Andrew Coppin" <[e-mail]>
Subject: Re: (fractint) C-FOTDs
Date: 27 Nov 2000 15:33:32 -0000

>From: Lee Skinner <[e-mail]>
>Reply-To: [e-mail]
>To: [e-mail]
>Subject: (fractint) C-FOTDs
>Date: Mon, 27 Nov 2000 07:13:13 -0500
>
>I'd love to see those pars, Andrew.  Here's one for you (slow, but worth
>it!)
>
>61124009 <SNIP>

Well, I've typed the formula back in from memory here at uni (I did the
origanol at home). And the map wasn't bud1.map, in fact I can't remember
what is was at all. But the .par below shows a good approximation of what I
had...

---BEGIN CUBIC.FRM---
CubicJulia { ; By Andrew Coppin, [e-mail]
  A = p1
  B = p2
  Z = Pixel
  T = 3*Sqr(A):
    Z = Z*Z*Z - T*Z + B
  |Z| < 4
}

CubicMandelUnion { ; By Andrew Coppin, [e-mail]
  ; If real(p1) = 0, draw B-plane, else A-plane.
  IF(real(p1)>0)
    A = Pixel
    B = p2
  ELSE
    A = p2
    B = Pixel
  ENDIF
  ZP =  A
  ZM = -A
  T = 3*Sqr(A):
    ZP = ZP*ZP*ZP - T*ZP + B
    ZM = ZM*ZM*ZM - T*ZM + B
    IF(|ZP|>|ZM|)
      Z = ZP
    ELSE
      Z = ZM
    ENDIF
  |Z| < 4
}
---END CUBIC.FRM---

---BEGIN CUBIC.PAR---
Shaddows           { ; Weird...
  reset=2000 type=formula formulafile=cubic.frm
  formulaname=CubicMandelUnion passes=g
  center-mag=-0.61165285379202610/+0.15953079178885670/32.96414
  params=1/0/0.5/0 float=y maxiter=4096 inside=255
  colors=mob<9>YjdXidVhdUhdSgdQfe<3>NcbNbaMa`L`_<7>BNMALL8JJ7IH<3>3CB2AA29\
  9<2>366356245234235236<3>22D31F42H42J53M64P<10>L3iM3kN3m<3>T2uU1vV1xX0z<\
  9>TJzSKzSMzROzRQzQSz<9>YYtYZtZ_s<2>aaqbbpddr<3>llz<3>hasgZqeWo<10>ZFbYD`\
  YB_XAZW8YV6W<12>I2JH1IG1H<2>D0DC0CB1B<3>727626255244333222<2>414515717<2\
  >B0DC0FC0H<3>G0PH0RH0S<8>K0fL0hL0j<2>M0oN0qN0q<7>S7tT8tT8uU9uVAuVBv<10>k\
  IelJcnJaoK`qLZsMX<3>rQWrSVrTV<2>rYUrZUr`VraVrcVrdVqfW<3>qkbqmdqnfqphqqjp\
  sl<4>oqf000kkk
  }
---END CUBIC.PAR---

I have a feeling Hotmail is going to word-wrap that. Oh well. It renders at
1280x1024 in under 10 minuites, so it's not that slow in the grand scheme of
things. You'll notice it sets params=1/0/0.5/0.
That means "draw the A-Plane, with B=0.5+0i". I've done a little zoom in.
But everywhere you look you find shaddows. Very strange effect. If anyone
comes up with any good .pars for this formula, let me know!!!

_____________________________________________________________________________________
Get more from the Web.  FREE MSN Explorer download : http://explorer.msn.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Andrew Coppin" <[e-mail]>
Subject: Re: (fractint) C-FOTDs
Date: 27 Nov 2000 15:44:37 -0000

>From: Lee Skinner <[e-mail]>
>Reply-To: [e-mail]
>To: [e-mail]
>Subject: (fractint) C-FOTDs
>Date: Mon, 27 Nov 2000 07:13:13 -0500
>
>I'd love to see those pars, Andrew.  Here's one for you (slow, but worth
>it!)
>
>61124009           { ;                                       t=  5:03:03.47
>                      ; on a P233 at 1600x1200  Nov 27, 2000  05:07:51
>                      ; Image Copyright 2000 by Lee H. Skinner ver=2001
>                      ;  Version 2001 Patchlevel 3
>   reset=2001 type=formula formulafile=fractint.frm
>   formulaname=mandelbrotmix4 function=recip passes=1
>   center-mag=+2.71707619839821900/-0.94866867868312280/5936.513/1/-122.5
>   params=15/-1.15/1/-11.5/-2/500 float=y maxiter=3600 inside=0
>   logmap=231 symmetry=none periodicity=9
  <SNIP!>

formulafile=fractint.frm
formulaname=mandelbrotmix4
Not on my system! Oh well, I'll have to wait for Jim's next C-FOTD,
in which he will inevatably repost that formula. (Well... maybe he'll just
my MandelbrotBC formula instead... or maybe even CubicMandelUnion! I can
dream can't I?...)

_____________________________________________________________________________________
Get more from the Web.  FREE MSN Explorer download : http://explorer.msn.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 28-11-00 (Spooky Radicals [4])
Date: 27 Nov 2000 20:48:48 -0500 (EST)


Classic FOTD -- November 28, 2000 (Rating 4)

Fractal visionaries and enthusiasts:

Does two have a square roof?  According to yesterday's C-FOTD it
does.  It also has a square root, but then so does a tree
growing in a square pot.  But regardless of whether the roof or
root is square, the image is the same.

This morning's letter from Andrew Coppin that mentions the
square roof also mentions spooky things that sometimes happen in
the world of fractals, where ghosts of things that no longer
exist are sometimes visible.  I can't comment on the fractal
that Andrew was referring to because I have not seen it, but I
have done lots of experimenting with fractal ghosts in my 13
years of fractaling.

These ghosts are quite common, needing only the proper color
scheme to make them evident.  They exist in all planes and all
orientations of four-dimensional Julibrots except the Julia
sets.  Today's picture shows some very obvious ghost-buds in one
of the perturbed Mandelbrot sets.

The ghosts are indeed shadows of things that exist in other
planes.  In today's picture, the brilliant bud-like outlines in
the background are shadows of the buds that exist at the same
coordinates in the unperturbed Mandelbrot set.  To see the buds
unobscured, simply change the Z parameters of today's image to
0,0.

The reason the ghosts exist can be explained by the geometry of
the four-dimensional Julibrot.  I'll not go into the involved
explanation at this time, other than to say that the Mandelbrot
shape exists as an interrupted 4-D hypercylinder in the Julibrot.

The coloring of today's image was done with the under-utilized
ranges and banding features of Fractint.  A total of only 13
colors are used in the image, though the impression is one of
far more colors.

I named the picture "Spooky Radicals" after the ghost-like
outlines of the buds.  (A radical consists of a bud plus all its
associated filaments and midgets.)  I rated the picture a 4,
which may be a bit modest.

With a render time of just under 5 minutes, running the
parameter file risks impatience.  The remedy is to download the
GIF image file from:

          <alt.binaries.pictures.fractals>

or from:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today was partly sunny, with a temperature
of 57F (14C), which was mild enough for the fractal cats to
enjoy several hours out of doors.

The philosophy is still stifled by the ridiculous political
situation here in the U.S., which is giving me no end of
frustration.  I suppose we'll have no philosophy until we have
a president.

Right now, I'm going to ignore a couple pressing tasks and have
myself an enjoyable evening before the TV.  I'll return tomorrow
with fractal and blather.  Until then, take care, but not so
much care that it stops being fun.


Jim Muth
[e-mail]


START 20.0 PARAMETER FILE==================================

Spooky_Radicals    { ; time=0:04:44.18 -- SF5 on a P200
  reset=2000 type=mandel passes=1
  center-mag=-0.20959612173315630/+0.64448795330341930\
  /817.6347/1/-7.499 params=0.75/-0.45 float=y
  maxiter=32767 inside=13 logmap=46 periodicity=10
  ranges=0/-1/240/250/270/310/390/640/990/1400/2500/50\
  00/32767 sound=off
  colors=000K00YPQUK5<4>UhUUmZUrccwmhzzOKX000<240>000
  }

END 20.0 PARAMETER FILE====================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Andrew Coppin" <[e-mail]>
Subject: Re: (fractint) C-FOTD 28-11-00 (Spooky Radicals [4])
Date: 28 Nov 2000 11:02:13 -0000

>From: Jim Muth <[e-mail]>
>Reply-To: [e-mail]
>To: [e-mail]
>CC: [e-mail]
>Subject: (fractint) C-FOTD 28-11-00 (Spooky Radicals [4])
>Date: Mon, 27 Nov 2000 20:48:48 -0500 (EST)
>
>
>Classic FOTD -- November 28, 2000 (Rating 4)

>This morning's letter from Andrew Coppin that mentions the
>square roof also mentions spooky things that sometimes happen in
>the world of fractals, where ghosts of things that no longer
>exist are sometimes visible.  I can't comment on the fractal
>that Andrew was referring to because I have not seen it, but I
>have done lots of experimenting with fractal ghosts in my 13
>years of fractaling.

Jeepers creepers! Now *that* is one unusual image! Nice one!

If you (or anyone else) wants to see the image I mentioned without fiddling
around with the .par I posted, fire up your fav. browser and type

http://lyta.mk.dmu.ac.uk/~khcm8ac/DWeb/Assign/FI20/Shaddows.gif

This will show you a 1280x1024 GIF of the image that got me so excited. I
really have no idea how it works (the single-orbit version shows no such
shaddows, so it's not a feature of the cubic formula, it must be my
dual-orbit logic). The further I zoom, the more interesting stuff I find.

Now here's a challenge: I have yet to find any midgets within this image.
Can Jim or anyone else do so? (Without changing the parameters from
param=1/0/0.5/0!) Can I do it first? We shall see...

Let's race!
Andrew.

_____________________________________________________________________________________
Get more from the Web.  FREE MSN Explorer download : http://explorer.msn.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Multiple Bogeys" <[e-mail]>
Subject: Re: (fractint) C-FOTD 28-11-00 (Spooky Radicals [4])
Date: 28 Nov 2000 07:58:01 -0500

Funky. I've seen this kind of thing before with formulas that combine
multiple critical points. It's normal, but cool.

_____________________________________________________________________________________
Get more from the Web.  FREE MSN Explorer download : http://explorer.msn.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) Re: C-FOTD 28-11-00
Date: 28 Nov 2000 08:58:17 -0500 (EST)

At 11:02 AM 11/28/00 -0000, Andrew Coppin wrote:

      <snip>
>Now here's a challenge: I have yet to find any midgets within this image.
   [found at]

    <http://lyta.mk.dmu.ac.uk/~khcm8ac/DWeb/Assign/FI20/Shaddows.gif>

>Can Jim or anyone else do so? (Without changing the parameters from
>param=1/0/0.5/0!) Can I do it first? We shall see...
>
>Let's race!

The race would be futile unless the parameters are changed.  The present
parameters draw a fractal with perturbed Mandelbrot features, and such
fractals do not contain intact Mandelbrot midgets.

Jim M.


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Andrew Coppin" <[e-mail]>
Subject: Re: (fractint) Re: C-FOTD 28-11-00
Date: 28 Nov 2000 14:07:45 -0000

>From: Jim Muth <[e-mail]>
>Reply-To: [e-mail]
>To: [e-mail]
>Subject: (fractint) Re: C-FOTD 28-11-00
>Date: Tue, 28 Nov 2000 08:58:17 -0500 (EST)
>
>At 11:02 AM 11/28/00 -0000, Andrew Coppin wrote:
>
>       <snip>
> >Now here's a challenge: I have yet to find any midgets within this image.
>    [found at]
>
>     <http://lyta.mk.dmu.ac.uk/~khcm8ac/DWeb/Assign/FI20/Shaddows.gif>
>
> >Can Jim or anyone else do so? (Without changing the parameters from
> >param=1/0/0.5/0!) Can I do it first? We shall see...
> >
> >Let's race!
>
>The race would be futile unless the parameters are changed.  The present
>parameters draw a fractal with perturbed Mandelbrot features, and such
>fractals do not contain intact Mandelbrot midgets.
>
>Jim M.

Fantastic. I'm beaten before the race even starts!

I wonder... the B-plane seems to draw more intact features... maybe I can
find something here.

BTW. I have found an almost-intact midget in with the parameters above. It
has the classic cardiod body and the period 2 bud with its negative tail,
but the sides are missing!

As a matter of interest, BOF recons that all quadratic fractals are
equivalent to the classic Z^2 + C by a change of variables, and that all
cubics are equivalent to the formula I used (Z^3 - 3(A^2) + B). I don't get
it. Does anyone else?

_____________________________________________________________________________________
Get more from the Web.  FREE MSN Explorer download : http://explorer.msn.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Mike Traynor <[e-mail]>
Subject: Re: (fractint) C-FOTDs
Date: 28 Nov 2000 15:21:21 -0500

Andrew,

> CubicJulia { ; By Andrew Coppin, [e-mail]
>   A = p1
>   B = p2
>   Z = Pixel
>   T = 3*Sqr(A):
>     Z = Z*Z*Z - T*Z + B
>   |Z| < 4
> }

I already have a similar formula called CubicJulia in my orgform collection (not my formula, in
case that is not clear).  Is the formula above supposed to differ, or is it a product of your
being at uni and not home when you posted? Here it is:

CubicJulia {
  A = p1
  B = p2
  T = 3*A*A
  Z = Pixel:
  Z = Z*Z*Z - T*Z + B
  |Z| < 4
  ;SOURCE: 99msg.frm
}


Mike

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Tim Wegner <[e-mail]>
Subject: (fractint) linux/X's 24bit pixels
Date: 28 Nov 2000 16:47:10 -0600

Note: the author tried to post this to the fractint list, but couldn't
because he is not a member, so I posted it.

Tim

From [e-mail] Tue Nov 28 06:59:16 2000
Message-ID: <Pine.LNX.3.96.1001128070839.21271A-100000@localhost>
MIME-Version: 1.0
Content-Type: TEXT/PLAIN; charset=US-ASCII


I have rudely and naively hacked up xfractint-3.10 and hard-wired it for
24bit colored pixels under Linux/X3.3.6. It is a mess, not suited for
distribution in any respect. No fancy color hacks or anything and there
are lots of, um, issues, outstanding. Is there any interest in this? It is
still buggy  to be sure, but, more or less, at least it is color (heres' a
png screenshot. It shows Xfractint  with that wonderful ;-) vga dac color
map and also shows some compression-distorted xwininfo info (235k):
http://members.nbci.com/mlarch/xfractint-screenshot.png ).


I don't know what the state of things are with fractint and Linux and X,
I'm way way out of the loop, someone else may have done (probably did do)
this long long ago. Whatever. If your interested there is a a tar.gz at
http://members.nbci.com/mlarch/xf-hacks.tar.gz (104k)


P.S.
I am not on the fractint mailing list so if you wish to contact me use:
mailto://[e-mail]


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 29-11-00 (The Minibrot Blues [6])
Date: 28 Nov 2000 18:58:06 -0500 (EST)


Classic FOTD -- November 29, 2000 (Rating 6)

Fractal visionaries and enthusiasts:

On some days I just can't find a fractal.  Those days give me
the minibrot blues, which just happens to be the name I attached
to today's C-FOTD.  The image, with its somber blues and
purples, effectively captures the mood I feel when unable to
find my Classic Fractal of the Day.

After studying the picture for all of 2 minutes, I rated it a 6,
which is 2 points higher than yesterday's spooky C-FOTD.
Actually, I would have rated yesterday's image 3 or 4 points
higher, had I not already done so many of this type of image
over the years.

The fractal formula 2Z^(-1.2)+0.4Z^(-12)+(1/C) was iterated by
M-Mix4 to create today's image.  The render time of the attached
parameter file is around 8 minutes on a 200mhz Pentium machine,
making it quicker to download the GIF image from:

          <alt.binaries.pictures.fractals>

or:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

For all who are interested, the weather today at Fractal Central
was partly sunny and 56F (13C) -- conditions the fractal cats
approved of.  They showed their approval by passing the
afternoon lounging in the off-and-on sun.  When the sun went
behind the hemlock tree, they came indoors for their meal.

That's it for now.  I'll be back in 24 or so hours with more
fractal surprises.  Until then, take care, and be surprised.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

The_Minibrot_Blues { ; time=0:07:44.42 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=+14.81958856094954000/+10.489897672886060\
  00/1.672409e+007/1/177.499 params=2/-1.2/0.4/-12/0/0
  float=y maxiter=1350 inside=0 logmap=151 periodicity=9
  colors=000CIWGIZKI`NKbSIfVGhZEjaBmf9pi7sm4up3wp8y<2>\
  pMzmLvjKnhIefHYbGO`FGZE7WC0VC1UC3TC6SC8QC9PCCOCGNCKM\
  CNLCQKCU<3>FCgECjCCnBCqACu9Cx8Cz8Cz<3>E7eF6_G4UH3OI2\
  IH3CG3C<2>E3GE3HC4K<3>94O94P86S76T76U66V46W46Y37_27`\
  <2>0Ec0Ge2Ig<3>ASkBUmEWoGZpH`qKbsMetN_uPUpQOkTKg<3>Z\
  LP`LLaLGcLBeL7fL2gN4hO7iQ8iSAjUBkVEmWFmZHn_IoaLpbMpe\
  OqfPsgStiTtjVumWvnZvo_qmamjbiheeff`cgYaiT_jOYmLVnGTo\
  BQq8Os3Mu0Kv0Hw0Is3Kn<3>INWMOSQONUPIYQE`Q9cTAgVBjWBn\
  ZCp_CtaEwbEzeF<2>zhGziGyjGxkG<3>vpHuqHtsHttHsuHqvHqw\
  HpxK<2>pxNpxPpzQpyQ<6>pz`pzapzbpzcpzfpzgpzhvK0<4>uN2\
  uO3uO4uP4uQ6uQ6uS7<6>tWBtWCtYCtYE<5>taIsaIsbKsbKscLs\
  eM<3>sgOsgOshPsiQsiQsjSqjSqkTqkUqmUqmVqnVqoWqoY<2>qq\
  Zqq_qs`<3>pubpvcpve<2>pwe
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Morgan L. Owens" <[e-mail]>
Subject: Re: (fractint) Re: C-FOTD 28-11-00
Date: 29 Nov 2000 19:51:45 +1300

At 14:07 28/11/2000 +0000, Andrew Coppin asked:
>As a matter of interest, BOF recons that all quadratic fractals are
>equivalent to the classic Z^2 + C by a change of variables, and that all
>cubics are equivalent to the formula I used (Z^3 - 3(A^2)Z + B). I don't
>get it. Does anyone else?

It's a little more elaborate than necessary, in fact. z^3+az+b will do just
fine.

Let's start with a pretty general cubic formula:

z^3+az^2+bz+c

If the coefficient of z^3 had been anything other than 1 we could have
divided by it without affecting any of the cubic's features. We're safe in
dividing, because if said coefficient had been zero, it wouldn't have been
a cubic in the first place.

Now, the "change of variables" bit. We replace z with w-a/3. This shifts
the coordinate axes a bit (in two dimensions drawn in the conventional
manner, it slides the horizontal axis up and down). But it doesn't distort
the cubic itself. So when you're done you can substitute w=z+a/3 back into
the result to shift the axes back to where they were. (This is the just the
same sort of argument as I used when justifying my division).

So, what happens when we replace z with w-a/3? Well, here we go: watch in
particular what happens to the square term. Keep your eye on the ball.

(w-a/3)^3+a(w-a/3)^2+b(w-a/3)+c
=
w^3-(a^2/3+b)w+2a^3/27-ab/3+c

...and it disappears in a puff of algebra. If I used Q to represent
-(a^2/3+b) and P for 2a^3/27-ab/3+c this would be

w^3+Qw+P

Which is a lot more compact. It's not instantly clear to me why BoF has the
more elaborate version; perhaps fiddling with the parameters in both
versions to see what they do will suggest something.

Beginning of digression. If I can stick with real arithmetic for a moment,
you could represent every possible cubic by a single point on the Q-P
plane, coloured, say, on the basis of the number of points where its
derivative is zero. You'll get a sort of inside-out-parabola cum curved-V
shape in one colour; with the space between the arms a second colour, and
the rest a third. This shape is known in catastrophe theory as a "cusp".
End of digression.


The quadratic z^2+az+b I leave as an exercise for the reader.

Morgan L. Owens
"'Bout time I let someone else answer these sorts of questions!"



Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) C-FOTD 30-11-00 (A Riot of Colors [6])
Date: 29 Nov 2000 23:54:42 -0500 (EST)


Classic FOTD -- November 30, 2000 (Rating 6)

Fractal visionaries and enthusiasts:

I have rarely seen a fractal so filled with colors.  If
anything, the name "A Riot of Colors" is an understatement, the
effect of the image being one of carnival and merriment.  All in
all it is quite a contrast to yesterday's depressing image,
though both images rate a slightly above average 6.

The expression 0.53(1/(Z^2)-2Z)+(1/C), which drew the image, may
appear random, but the factors are actually quite critical.  The
render time of the parameter file is a slow 15+ minutes -- slow
enough to cause an irresistible urge to download the GIF image
file from:

          <alt.binaries.pictures.fractals>

or from:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today was increasingly cloudy with a
temperature of 52F (11C), which was marginal for the cats
outdoor adventure.  At nightfall a cold rain accompanied by a
little thunder moved in, bringing the day to an inauspicious
close.

But it's now time to bring my day to an auspicious close.  Until
tomorrow at this same time and place, when I plan a trip into
the fourth dimension, take care, and see you then.


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

A_Riot_of_Colors   { ; time=0:15:14.13 -- SF5 on a P200
  reset=2001 type=formula formulafile=critical.frm
  formulaname=MandelbrotMix4 function=recip passes=1
  center-mag=+0.05093424425905903/+0.21086081060670720\
  /3504462/1/-92.5 params=1/-2/-2/1/-0.47/0 float=y
  maxiter=3300 inside=0 logmap=232 periodicity=10
  colors=0003fA3eA<2>y2h<3>oDcmGajI`hL_fNZ<3>oZNqaLsdI\
  <2>ymA<9>epAcpAapA<3>VqA<3>`aHaYIbUKdQLeMNfJOjCPn5P<\
  5>UJFRMDNOB<3>AX5<8>AkEAlFAnG<3>AtK<3>agv<4>dPbeMZeI\
  V<3>g4G<3>WAMTCOQDPNFRLGS<3>zco<4>oacmaal`_<3>d_Rb_P\
  a_N<6>ZRZYQ`YOb<3>XKh<2>rtj<8>NPLJMJGIG<3>255<2>mcb<\
  3>ShZMjYHkXBlW6mV<3>dRNlMLkQN<4>geTfiVelW<2>bv_by``v\
  _<6>RaVPZVOWU<3>ILS<6>``MbbLeeL<3>omI<3>hrIftIduIbvI\
  awIdxLfyO<3>nzYpz`rzc<2>xzj<3>_zRUzMOzHIzD<2>Xzj<3>N\
  zSKzNIzJ<2>Czp<3>NzqPzqSzq<3>azr6zA<3>4zA
  }

frm:MandelbrotMix4 {; Jim Muth
a=real(p1), b=imag(p1), d=real(p2), f=imag(p2),
g=1/f, h=1/d, j=1/(f-b), z=(-a*b*g*h)^j,
k=real(p3)+1, l=imag(p3)+100, c=fn1(pixel):
z=k*((a*(z^b))+(d*(z^f)))+c,
|z| < l
}

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Andrew Coppin" <[e-mail]>
Subject: Re: (fractint) C-FOTD 30-11-00 (A Riot of Colors [6])
Date: 30 Nov 2000 10:32:04 -0000

>From: Jim Muth <[e-mail]>
>Reply-To: [e-mail]
>To: [e-mail]
>CC: [e-mail]
>Subject: (fractint) C-FOTD 30-11-00 (A Riot of Colors [6])
>Date: Wed, 29 Nov 2000 23:54:42 -0500 (EST)
>
>
>Classic FOTD -- November 30, 2000 (Rating 6)

I'm sorry, but I'd rate this one more like 7 or even 8! It looks *trippy*!
If only *I* could come up with colours like that...

_____________________________________________________________________________________
Get more from the Web.  FREE MSN Explorer download : http://explorer.msn.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Andrew Coppin" <[e-mail]>
Subject: Re: (fractint) C-FOTDs
Date: 30 Nov 2000 10:34:07 -0000

A few moments comparisom proves that they are indeed identical (except that
the OrgForm version uses T = 3*A*A, whereas I use T = 3*Sqr(A), so one may
theoretically be faster - not sure which though!)

>From: Mike Traynor <[e-mail]>
>Reply-To: [e-mail]
>To: [e-mail]
>Subject: Re: (fractint) C-FOTDs
>Date: Tue, 28 Nov 2000 15:21:21 -0500
>
>Andrew,
>
> > CubicJulia { ; By Andrew Coppin, [e-mail]
> >   A = p1
> >   B = p2
> >   Z = Pixel
> >   T = 3*Sqr(A):
> >     Z = Z*Z*Z - T*Z + B
> >   |Z| < 4
> > }
>
>I already have a similar formula called CubicJulia in my orgform collection
>(not my formula, in
>case that is not clear).  Is the formula above supposed to differ, or is it
>a product of your
>being at uni and not home when you posted? Here it is:
>
>CubicJulia {
>   A = p1
>   B = p2
>   T = 3*A*A
>   Z = Pixel:
>   Z = Z*Z*Z - T*Z + B
>   |Z| < 4
>   ;SOURCE: 99msg.frm
>}
>
>
>Mike
>
>--------------------------------------------------------------
>Thanks for using Fractint, The Fractals and Fractint Discussion List
>Post Message:   [e-mail]
>Get Commands:   [e-mail] "help"
>Administrator:  [e-mail]
>Unsubscribe:    [e-mail] "unsubscribe fractint"

_____________________________________________________________________________________
Get more from the Web.  FREE MSN Explorer download : http://explorer.msn.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Andrew Coppin" <[e-mail]>
Subject: Re: (fractint) Re: C-FOTD 28-11-00
Date: 30 Nov 2000 10:41:07 -0000

>From: "Morgan L. Owens" <[e-mail]>
>Reply-To: [e-mail]
>To: [e-mail]
>Subject: Re: (fractint) Re: C-FOTD 28-11-00
>Date: Wed, 29 Nov 2000 19:51:45 +1300
>
>At 14:07 28/11/2000 +0000, Andrew Coppin asked:
>>As a matter of interest, BOF recons that all quadratic fractals are
>>equivalent to the classic Z^2 + C by a change of variables, and that all
>>cubics are equivalent to the formula I used (Z^3 - 3(A^2)Z + B). I don't
>>get it. Does anyone else?
>
>It's a little more elaborate than necessary, in fact. z^3+az+b will do just
>fine.

I've tried that. It seems to draw a different image in Mandelbrot mode,
though the Julia sets are still the same (if you change parameters).

>Let's start with a pretty general cubic formula:
>
>z^3+az^2+bz+c
>
>If the coefficient of z^3 had been anything other than 1 we could have
>divided by it without affecting any of the cubic's features. We're safe in
>dividing, because if said coefficient had been zero, it wouldn't have been
>a cubic in the first place.

Figures.

>Now, the "change of variables" bit. We replace z with w-a/3. This shifts
>the coordinate axes a bit (in two dimensions drawn in the conventional
>manner, it slides the horizontal axis up and down). But it doesn't distort
>the cubic itself. So when you're done you can substitute w=z+a/3 back into
>the result to shift the axes back to where they were. (This is the just the
>same sort of argument as I used when justifying my division).

Fine.

>So, what happens when we replace z with w-a/3? Well, here we go: watch in
>particular what happens to the square term. Keep your eye on the ball.
>
>(w-a/3)^3+a(w-a/3)^2+b(w-a/3)+c
>=
>w^3-(a^2/3+b)w+2a^3/27-ab/3+c
>
>...and it disappears in a puff of algebra.

OK, I'm going to have to spend half an hour crawling through that is
super-slo-mo, but I believe you.

>If I used Q to represent
>-(a^2/3+b) and P for 2a^3/27-ab/3+c this would be
>
>w^3+Qw+P
>
>Which is a lot more compact. It's not instantly clear to me why BoF has the
>more elaborate version; perhaps fiddling with the parameters in both
>versions to see what they do will suggest something.

Like I said, the no difference in the Julia sets (except that you use
different A/B to get the same image depending on which formula you use). But
the Mandelbrot images (in the A-plane or any B-Plane where A<>0) are
definitly different. The BoF version gives less "mangled" looking images.
IDK Y.

>Beginning of digression. If I can stick with real arithmetic for a moment,
>you could represent every possible cubic by a single point on the Q-P
>plane, coloured, say, on the basis of the number of points where its
>derivative is zero. You'll get a sort of inside-out-parabola cum curved-V
>shape in one colour; with the space between the arms a second colour, and
>the rest a third. This shape is known in catastrophe theory as a "cusp".
>End of digression.
>
>
>The quadratic z^2+az+b I leave as an exercise for the reader.

Never mind that... I'm gonna attempt the quartic! (Prepair to hear
confirmation of my failure any time soon!)

>Morgan L. Owens
>"'Bout time I let someone else answer these sorts of questions!"

<grin> Does any one else out there know/care how to answer?

Andrew.
"You wouldn't believe the amount of code I wrote to make a JavaScript
complex number calculator!"

_____________________________________________________________________________________
Get more from the Web.  FREE MSN Explorer download : http://explorer.msn.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Andrew Coppin" <[e-mail]>
Subject: Re: (fractint) C-FOTDs
Date: 30 Nov 2000 10:53:33 -0000

>From: "Andrew Coppin" <[e-mail]>
>Reply-To: [e-mail]
>To: [e-mail]
>Subject: Re: (fractint) C-FOTDs
>Date: Mon, 27 Nov 2000 15:44:37 -0000
>
>>From: Lee Skinner <[e-mail]>
>>Reply-To: [e-mail]
>>To: [e-mail]
>>Subject: (fractint) C-FOTDs
>>Date: Mon, 27 Nov 2000 07:13:13 -0500
>>
>>I'd love to see those pars, Andrew.  Here's one for you (slow, but worth
>>it!)
>>
>>61124009           { ;                                       t=
>>5:03:03.47
>>                      ; on a P233 at 1600x1200  Nov 27, 2000  05:07:51
>>                      ; Image Copyright 2000 by Lee H. Skinner ver=2001
>>                      ;  Version 2001 Patchlevel 3
>>   reset=2001 type=formula formulafile=fractint.frm
>>   formulaname=mandelbrotmix4 function=recip passes=1
>>   center-mag=+2.71707619839821900/-0.94866867868312280/5936.513/1/-122.5
>>   params=15/-1.15/1/-11.5/-2/500 float=y maxiter=3600 inside=0
>>   logmap=231 symmetry=none periodicity=9
>  <SNIP!>
>
>formulafile=fractint.frm
>formulaname=mandelbrotmix4
>Not on my system! Oh well, I'll have to wait for Jim's next C-FOTD,
>in which he will inevatably repost that formula. (Well... maybe he'll just
>my MandelbrotBC formula instead... or maybe even CubicMandelUnion! I can
>dream can't I?...)

OK, I now have the required .FRM on my system. That is indeed a slow image.
And it does indeed look like it would be well worth compleating. I'll take
the par home and run it on my AMD Duron 700MHz!

Thanks Lee.
Andrew.

_____________________________________________________________________________________
Get more from the Web.  FREE MSN Explorer download : http://explorer.msn.com


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: "Barry N. Merenoff" <[e-mail]>
Subject: Re: (fractint) Re: C-FOTD 28-11-00
Date: 30 Nov 2000 17:16:21 -0500

Message text written by INTERNET:[e-mail]
>I've tried that. It seems to draw a different image in Mandelbrot mode, =
<

Did you remember to change the starting value to the new critical point?

Sincerely,
        Collin

Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"


-------------------------------------------------------------------------------

From: Jim Muth <[e-mail]>
Subject: (fractint) FOTD 01-12-00 (4D-01 [NA])
Date: 30 Nov 2000 23:43:13 -0500 (EST)


FOTD -- December 01, 2000 (Rating NA)

Fractal visionaries and enthusiasts:

At first glance, today's fractal may appear disappointing, but
don't give up hope too soon, for today we begin our 12-day
journey into the fourth dimension, that impossible yet real
abstraction where planes intersect in a single point and
surfaces have three-dimensional volume.

The object of investigation is the period-4 bud on the northeast
shore of the main bay of the Mandelbrot set.  This bud, along
with many of its associated filaments and midgets, is clearly
illustrated in today's FOTD.  The bud is described as being of
period-4 because the iterated points within it have four
separate attractors.

I have not given today's image a name or rating because it not a
separate unit, but rather the first in a series of 12 images,
which must be considered as the unit.  The series of images will
follow the bud in today's image as it moves and rotates through
the fourth dimension and eventually becomes its own Julia set.
On the way, it will become clear that the actual four-
dimensional shape of the bud is that of a hypercylinder.

As a matter of interest, the mouth of the bud is located at the
C coordinates of 0.25+0.50i.  The center lies at C=0.281+0.531i,
and the mouth of the bud is tilted at an angle of exactly 45
degrees.  It is a very familiar feature of the Mandelbrot set,
so familiar in fact that little attention is usually given to
it.  The things I will do to the bud in the next 11 images
however should shake most of the familiarity out of it, and
explain the four-dimensional nature of the Mandelbrot set, Julia
sets, and Julibrot as well.

Today's image as well as the eleven following images will render
from their parameter files in a few seconds, making the download
superfluous.  But for those who would still prefer the download,
the GIF image file may be found on Usenet at:

          <alt.binaries.pictures.fractals>

and on the web at:

          <http://home.att.net/~Paul.N.Lee/FotD/FotD.html>

The fractal weather today was cold and windy.  Winter is now
setting in fast, and today's temperature of 42F (5.5C) along
with howling winds made it feel like winter has fully arrived.
The fractal cats dislike winter.  They'll most likely spend the
next several months as they spent today -- curled by the warmest
radiator.

I'll shut down the fractal shoppe at this time, but the 4-D
story will continue tomorrow and for the following 10 days as
well.  Until next time, take care, and can an abstraction be
real?


Jim Muth
[e-mail]


START 20.0 PAR-FORMULA FILE================================

4D-01              { ; time=0:00:40.34 -- SF5 on a P200
  reset=2001 type=formula formulafile=multirot.frm
  formulaname=multirot-XY-ZW function=flip/ident
  passes=t center-mag=-1.11022e-016/8.32667e-017/10.4\
  1667 params=0/0/0/0/0.281/0.531 float=y maxiter=3600
  inside=0 logmap=yes periodicity=10
  colors=00040P<4>90UA0VB2W<3>RF_VI`ZLa<3>nXbr_bvbbteb\
  vf`<3>ijWfkVcjV<8>MiVKiVIiV<3>AiV<5>WS`_PacMb<3>qAfu\
  CgxGguKh<4>SccWZp<9>cm`dnZdpY<3>guS<3>aqa`qdZpf<2>Vm\
  nUmpVlk<3>ZlU_lP`lK<2>bl7<9>ekOekPekR<2>fkWfkXhiY<3>\
  ld`nbaoaa<2>rYcigKaq0hd8nTGoHOmKQ<3>PTXJWZDY`7_a<3>D\
  cWFcVGdU<2>LgQMgPOfR<3>WqYXt_Zwa`xbbyd<3>izkkzmmzonz\
  p<3>czNazGZz9Xz2Yz6ZzA_zE<3>kzSnzWqz_tzbwzczzczzdzzd\
  <4>zzYzzXzzW<3>zzSzzKzzD<3>zzUzzYzz_<5>zzlzzozzq<2>z\
  zxzzzzzzzzzzzzzzzzzyzzxzzz<30>zzz
  }

frm:multirot-XY-ZW {; draws 6 planes and many rotations
;when fn1-2=i,f, then p1 0,0=M, 0,90=O, 90,0=E, 90,90=J
;when fn1-2=f,i, then p1 0,0=M, 0,90=R, 90,0=P, 90,90=J
a=real(p1)*.01745329251994, b=imag(p1)*.01745329251994,
z=sin(b)*fn1(real(pixel))+sin(a)*fn2(imag(pixel))+p2,
c=cos(b)*real(pixel)+cos(a)*flip(imag(pixel))+p3:
z=sqr(z)+c,
|z| <= 36  }

END 20.0 PAR-FORMULA FILE==================================


Thanks for using Fractint, The Fractals and Fractint Discussion List
Post Message:   [e-mail]
Get Commands:   [e-mail] "help"
Administrator:  [e-mail]
Unsubscribe:    [e-mail] "unsubscribe fractint"