>d3nlaa_ b.85.1.1 (A:) Type III antifreeze protein, AFP III {Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId: 36221]}
>d1nnja3 g.39.1.8 (A:224-271) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
algstgkmqnelqvygktgekcsrcgaeiqkikvagrgthfcpvcqqk
>d1hkxa_ d.17.4.7 (A:) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Mouse (Mus musculus) [TaxId: 10090]}
>d1c8aa2 b.85.1.1 (A:69-134) Type III antifreeze protein, AFP III {Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId: 36221]}